KEGG   Pangasianodon hypophthalmus (striped catfish): 113545743
Entry
113545743         CDS       T05759                                 

Definition
(RefSeq) putative transcription factor p65 homolog
  KO
K04735  transcription factor p65
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04010  MAPK signaling pathway
phyp04137  Mitophagy - animal
phyp04210  Apoptosis
phyp04218  Cellular senescence
phyp04620  Toll-like receptor signaling pathway
phyp04621  NOD-like receptor signaling pathway
phyp04622  RIG-I-like receptor signaling pathway
phyp04623  Cytosolic DNA-sensing pathway
phyp04625  C-type lectin receptor signaling pathway
phyp04920  Adipocytokine signaling pathway
phyp05132  Salmonella infection
phyp05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113545743
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    113545743
  09143 Cell growth and death
   04210 Apoptosis
    113545743
   04218 Cellular senescence
    113545743
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113545743
   04621 NOD-like receptor signaling pathway
    113545743
   04622 RIG-I-like receptor signaling pathway
    113545743
   04623 Cytosolic DNA-sensing pathway
    113545743
   04625 C-type lectin receptor signaling pathway
    113545743
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    113545743
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113545743
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    113545743
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:phyp03000]
    113545743
Transcription factors [BR:phyp03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    113545743
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 113545743
NCBI-ProteinID: XP_026801019
LinkDB
Position
Unknown
AA seq 687 aa
MAEMFGWGQPTVQQGTPYIEIIEQPKARGMRFRYKCEGRSAGSIPGEKSNDSTKTHPAIK
VHNYSGPIRVRISLVTKNQPYKPHPHELVGKDCKHGYYEADLPERRVHSFQNLGIQCVKK
KDVAEAVSCRLQTQNNPFNIPEAKVWEEEYDLNAVRLCFQATITLATGELYPLEPVVSQP
IYDNSESAEIKPTCTIVEIRMCKMNTHPTMAVSSENFRRRQVLVLQLKSKVYSVKRNGES
TVPWGAPVLQTTTSDTQSRNLTYCGLLVSRASAISSSILLEREQTFPMIIDVPHTRFSPS
EDIEVRFFRDSWESKGSFSQADVHRQVAIVFRTPPYCDTNLTEPVRVKMQLRRPSDREVS
EPMDFQYLPADPDEYRLMEKRKRTEGMLQNLKLGNTVSDTIPQRPYSTARRTFTAPKLSA
AASAPPVVNPVPCMGPVKPPPLFSTPAPGHLFTQTKTEPTPCNEDGWKFFSNVTVQPSAA
SAPSVTQDFRTVNLADLHDFSFSTYPPAAPDQSDSGSRRDGTSTNAAGTTVAQEVQNTFA
PSINLMDENEIPDFPSFSEAQTSDVENINTDEFQALLGQSGLPGDGTPATSVCHANAVGN
MTIDNALGSNGVEQVARNMGNGTWMSFPPSIVSLLQNEQMTDTGLPSTSATPVTLDDMDI
MNSMDEERLMSIVNCGNQVSFLSGHPT
NT seq 2064 nt   +upstreamnt  +downstreamnt
atggctgaaatgttcggctggggacagcccaccgtgcagcaaggcacaccgtacatcgag
atcatcgagcagcccaaagcaagagggatgcgctttcgttataaatgcgaggggagatca
gccggcagcattccaggagaaaagagcaacgattccaccaaaacacacccagccatcaag
gtgcataactacagtggcccaatcagagtgaggatctccttggttaccaagaaccagcca
tacaagccccacccacatgagctggtgggaaaagactgtaaacacggctactatgaagct
gacctgcccgagagacgggttcacagtttccagaatctcggtattcaatgtgtgaagaag
aaggatgtggccgaagctgtttcctgtcgcctgcaaacacagaacaacccttttaacatt
cccgaagccaaagtgtgggaggaagagtacgacctgaacgctgtccgcctctgtttccag
gcaaccatcaccctggcaaccggcgagctgtaccctctggagcctgtcgtctctcagccc
atctacgacaacagtgagtctgcagaaatcaaacccacatgcaccattgtggaaattaga
atgtgcaaaatgaatacacatccaacaatggctgtatcatctgagaactttcggaggagg
caagtgttagtgttacaactgaagtccaaggtgtacagtgtgaaaaggaacggggagagc
accgtgccctggggagccccggtattgcagactaccacctcagacacacagtcacgcaac
cttacatactgtggtctgttggtgagccgggctagcgccattagctcatccatcttattg
gagagggagcagacgtttcccatgataatagatgttccccatacacgattttccccctca
gaggacatcgaggtgcgcttcttccgagactcgtgggaaagtaaaggctcgttctctcag
gccgacgtccacaggcaggtcgccatcgtgttccgcacgccgccctactgcgatacaaac
ctgacggagcctgtgagagtgaagatgcagctccgaaggccatcagaccgcgaggtcagc
gagcccatggacttccagtacctccccgccgacccagatgagtacaggctgatggagaag
aggaagcggacagagggaatgctccaaaacctcaaactgggaaacactgtgtcagatacc
atccctcagaggccttacagtactgccagaagaacatttacagctccgaaactctcggct
gctgccagtgctccaccagtggtgaatcctgtgccatgcatgggtccagtgaaacctccg
cctttgttcagcactcctgctccgggccatctgttcactcagaccaaaactgagccgaca
ccttgtaatgaagacggatggaagtttttcagcaacgtcaccgtgcagccttctgctgct
tcagctccatccgtaactcaagacttccgcactgtcaatctcgccgacctgcacgacttc
tccttttctacttaccctcccgctgctccggatcaatctgactcgggcagcaggagggac
ggaaccagcactaacgcggccgggactacggtggcccaagaggtccaaaacacattcgcg
ccttccatcaacctgatggatgaaaacgagattccagatttccccagcttttctgaagct
cagacgtccgatgtggagaacatcaacactgatgagtttcaggcgctgttgggccaaagc
ggacttcctggagatggcactccggctacttcagtatgtcacgccaacgcggtgggaaac
atgaccatcgataacgcattgggttccaatggtgtggagcaggtggcgagaaacatgggc
aacggaacctggatgagtttcccaccaagcatcgtcagccttttgcagaacgagcagatg
acagacaccgggttgcccagcacatcggccacacccgtcaccctcgacgacatggacata
atgaactccatggacgaagaacggctcatgtccatcgttaactgcggcaaccaagtcagc
ttcctgtccgggcatcccacttag

DBGET integrated database retrieval system