KEGG   Pangasianodon hypophthalmus (striped catfish): 113546200
Entry
113546200         CDS       T05759                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-A-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04080  Neuroactive ligand-receptor interaction
phyp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113546200
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113546200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:phyp04030]
    113546200
G protein-coupled receptors [BR:phyp04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    113546200
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 113546200
NCBI-ProteinID: XP_026801765
LinkDB
Position
Unknown
AA seq 362 aa
MQNFSMLIAADVCEGREKNISFFYTVRNKTISQNWKARDFVVVGLGVPVCIFILLANLLV
MVAIIVNRRFHFPIYYLLGNMAAADLFAGISYLNLIFHTGPWTIGLTQNEWLVRGALIEM
SLTASVVNLLAVAWERHQSIFAMQLHSTMSNRRVLLFIVGIWVIAIIMGLVPTMGWNCVC
HIQSCSTVAPLYSRSFLVFWAVLNLITFSIMVAIYTRIFIYVRRKSQSTLQYTLNVRQND
TLIGLMKTVSMILGAFVICWTPGLVILLLDGLQCTGCQVLKYEKYCLVLAECNSLVNPII
YSCRDEDMRNTFKRILCFLCRRDREQEVEPSTIHSDTLKSERLLMEKYSDNYNHNHRERI
SS
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgcagaacttctccatgttgatcgcagctgatgtctgcgaaggacgcgagaagaacatt
tcatttttctacacggttagaaacaagaccatcagccaaaactggaaggcgagggacttt
gtggtggtgggactcggagtccccgtgtgcatcttcatcctcctcgccaacctgctggtg
atggtggccatcatcgtgaaccggcgcttccacttccccatctattacctgttgggcaat
atggcggcggcggacctgtttgccggcatctcctacctcaacctcatcttccacacgggg
ccgtggaccatcgggctcactcagaatgagtggctcgtgcgaggagcgctgatcgaaatg
agtctaacagcgtctgtggtcaacctgctggccgtggcatgggagagacaccagagcata
ttcgccatgcagctgcacagcaccatgtccaaccggcgtgtgctgctgttcatcgtgggt
atctgggtcatagcgatcatcatgggcctcgtccccaccatgggctggaactgcgtgtgc
cacattcaatcctgctccactgtggcgccgctctactcccgcagcttcctggtgttctgg
gctgtactcaacctcatcaccttctccatcatggtggccatatacacccgcatcttcatc
tacgtgcgccggaagagccagagcacgctgcagtacacacttaacgtcaggcagaatgac
acgctcatcgggctgatgaaaaccgtctccatgattctgggtgcctttgtgatctgctgg
acccccgggcttgtcatcctgctgctggacgggttgcagtgcacaggctgccaggtgctg
aaatacgagaagtactgcctggtcctggctgagtgcaactccctggtgaaccccatcatc
tactcgtgtcgcgacgaggacatgaggaacacgtttaagcgcatcctgtgtttcctgtgt
aggcgggacagggagcaggaggtcgagccgagtaccattcactcggacactttgaaatca
gagaggctgttgatggagaaatactcagacaactacaaccacaaccacagagagcgcata
tcttcctga

DBGET integrated database retrieval system