KEGG   Pangasianodon hypophthalmus (striped catfish): 113546335Help
Entry
113546335         CDS       T05759                                 

Gene name
zcchc2
Definition
(RefSeq) zinc finger CCHC domain-containing protein 2 isoform X1
  KO
K22700  Zinc finger CCHC domain-containing protein 2
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    113546335 (zcchc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CCHC Phenol_monoox
Motif
Other DBs
NCBI-GeneID: 113546335
NCBI-ProteinID: XP_026801924
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MLKMRLPAAEGDNDAAEGERRENNNGERGFLPFNPALEDEAGRGPAHAPRQLDKEAVFEW
FGLRLSPAKRVEFMCGLLHMCQPLELRFLGSCLEDLARKDFHILRDVEARANSPADLRLL
TDVADPVVLSRLLVCLSLLGSKNRECAGILYSTLSRIDVLHPRNCCGVGLNLPEPEPGPA
PLEQLALLFAMASLHPAFTFHQREVVRTQLERVEALLEERSLSHCACAAPTLQSQFSRPD
ELCPHPEGSRTWPSCPIQHLSSMPPSQVVHIEKIKLKEISLAGDSREYSFEVKWSDSSST
AVTKSHRELQDFLLKLCKEQSAGGFEQDVIGLLSRAEGEHRELERMLRARFASVPREFLQ
MCQASGFFLPEASSLHCSHSNSAPGARTRQPAPRFSEDCSETSSLDEDLDAYGVSRSRTH
NAGNTSHGKQHMDSAQWECSRRSTHGEPYGEVTGRRRSSQPCGTEPEQESEERKIKVRPA
GKRDRGRRGPVGKNSVANGIQRVPAVQLMNQGMCKASGRDTYGDTSSESSNSVPSSPVHH
QRSLETQDTESQSDNSVPEPADAPRRPHGQGTVRKAVAMVNPLVAEPEHAGADVPSHPSA
VVELALTSCLPYALQYSTAHRDAGKPGESKLTITIPLGKQDTRSSMAIPGDPAQCPLPPA
FPEPAQPQAPPSSIAAPGKPCAKASGQPQSPHTPSGLVQCPLAGTMPAQIPSSAPLPPPA
SMPTPSENAPYINNTAQSQPTGCNACGCRGTCGGSGAHQSPTTFFLPAHPNRQMFGPPAP
FFQLAPSLCSTTFPTQGHQGNGTPLPFYAHTSPSAAFAGSALLHAHSDHLMPAQPGYATL
PQVTPFGRFYPPVFPPVGAMPGAAGIKKSGTVSCYNCGMSGHYAQDCKQPSMDAGQPGGF
RLKYVAPHSSETLDKAD
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagatgaggctgccagcggcggagggagacaacgacgcggccgaaggcgagcga
cgggaaaacaacaacggcgagcgcggcttcctcccctttaaccccgcgctggaggacgag
gcgggccgcggacctgcgcacgctccccggcagctcgacaaggaggcggtgttcgagtgg
ttcggcttgcggctcagcccggccaagcgcgtggagttcatgtgcggtctgctccacatg
tgccagccgctcgagctgcgcttcctgggctcgtgtctcgaggacctggcgcggaaagac
ttccacattctgcgcgacgtcgaggctcgcgccaacagccccgccgacctgcgactcctc
accgacgtcgccgacccggtcgtgctctcgcgcctgctcgtctgcctctccctgctcggg
tctaagaaccgggagtgcgcggggatcctttacagcacgctgagccggatcgacgtgctg
cacccgaggaactgctgcggggtcggcttgaatttaccggaaccggaaccgggaccggct
ccactggagcagctggcgttgctcttcgccatggcctcgctgcacccggcgttcactttc
caccagagggaggtggtgcggacgcagctggagcgagtggaagcgttattggaggagagg
agcctgagccactgcgcctgcgcagctccaacactgcagagccagttttcccggccggat
gagctgtgtccacaccctgaggggagcagaacatggccgtcatgtccgatccagcacctc
agcagcatgcctccgagccaagtggtgcacattgagaagatcaaactgaaggagatctcc
ctggcaggagacagcagagagtacagcttcgaggttaaatggtccgactcgtcgtctacg
gctgtgaccaaaagtcatcgtgaactacaggactttcttttgaagctgtgtaaggaacag
agtgcgggagggttcgagcaggatgttatcggattactgagtcgggccgagggcgagcac
agagagctggagagaatgctcagggcgaggtttgcgtccgtgccacgggagttcctacag
atgtgccaggcctcggggtttttcctgcccgaagcgtcttccctacactgcagtcacagt
aacagtgcacctggagccagaacccgacagccggcacctcgcttctcagaggactgctca
gagacttccagcctcgatgaggaccttgacgcgtatggggtctcccgctcgagaacacac
aacgctggaaacacgagccatggtaagcagcacatggacagtgctcagtgggagtgcagc
aggaggagtacacacggcgaaccctacggggaggtgacggggaggaggcgcagctcccag
ccttgtgggacagaaccagagcaggagagtgaggagaggaagatcaaagtgagaccagca
ggcaaaagggacagaggcaggagaggcccagtggggaaaaactctgtagccaatgggatt
cagagagttcctgcagtccagctgatgaatcagggaatgtgtaaggcttcaggcagggac
acctacggagacacgtcttcagagagctccaactcagtgccgtcgagccccgtccaccat
cagcgcagcctggaaacacaagacacagagagtcagtcggataactccgtcccagagcca
gctgatgcaccgcgccgcccccacgggcagggcacagtcaggaaggcggttgccatggtg
aacccgctggtggcggaaccggagcatgcgggtgcagatgtaccgtcgcacccctcagct
gtggtggaactggcgctgacctcgtgcctcccctacgccctgcagtacagcaccgcccac
agagacgcaggcaaacccggggagagcaaactcaccatcacaatccctctgggcaaacag
gatacgaggtccagcatggccatccccggagaccccgcccagtgcccactgccgcccgcc
ttccctgagccagctcagcctcaggctccgcccagcagcattgctgctccggggaaacca
tgtgccaaggccagtgggcagccacagagccctcacacgccctccggtttagtccagtgt
cctctcgctggcaccatgcccgctcagatacccagctctgcgcctctaccgccccccgct
agcatgcccaccccgagcgagaacgcgccatacatcaataacactgcacagtcacaaccc
acaggctgcaacgcctgcggttgccgtggtacctgcggaggcagtggagcccaccagtct
cccaccactttcttcctgccggcgcatcccaaccgccagatgttcggcccacccgccccg
ttcttccagctggcaccatcgctgtgcagcaccaccttccctacacagggccatcaaggg
aacgggacgccgctgcccttctacgcccacacgtctccaagtgccgccttcgccggcagc
gcgctcctgcacgcccactcggaccacctgatgcccgcacagcccggctacgccaccctg
ccccaggtcacaccgttcggacgcttctacccacccgtcttccctcccgtgggtgccatg
cccggcgctgcaggaataaagaagagcggcaccgtgtcctgctataactgcggcatgagc
ggccactacgcgcaggactgcaagcagccgtccatggacgccgggcagccaggtggcttc
cggcttaagtatgtcgccccacattcgtcggagacactagacaaagctgattga

DBGET integrated database retrieval system