KEGG   Pangasianodon hypophthalmus (striped catfish): 113546553Help
Entry
113546553         CDS       T05759                                 

Definition
(RefSeq) G/T mismatch-specific thymine DNA glycosylase-like isoform X1
  KO
K20813  thymine-DNA glycosylase [EC:3.2.2.29]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    113546553
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:phyp03400]
    113546553
Enzymes [BR:phyp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.29  thymine-DNA glycosylase
     113546553
DNA repair and recombination proteins [BR:phyp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     113546553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDG GreA_GreB_N GAGA_bind
Motif
Other DBs
NCBI-GeneID: 113546553
NCBI-ProteinID: XP_026802287
LinkDB All DBs
Position
Unknown
AA seq 430 aa AA seqDB search
MDERSYGSLPHVPSDYVQHWVQSAQQHLQALHAQYSHMANGNVAHFMEGHGEEPGMMEMP
VHEPPAAPLEPGAPQQAPTKGKRGRAASKEPKAKPGPKPKKAKADKEGQPAEGTQEKIDE
SFKKVKRKVDRFKGMSEEEVMKKTLPDILTYNLDYVIIGINPGLMAAYIGRWFPGPGNHF
WKCLFLSGFTEQLLNHMHDQSLPEKYGIGFTNMVARATPGSKDLTSKELREGGKILVEKL
KKFKPLIAVFNGKCIYEMFCREIFGKKPKTLEFGLQPHKIPDSDTALYLMPSSSARCAQF
PRAQDKVHFYIKLRELRDQLKGVARPREVEEINYTFDLGMAKEDAKRMAIKEEQYDPGYE
AAYGGAYGEPGLEENNGHCAFASGEAEAAEKEPRNPNAVGQLPDGQWMTNSFADQIPEIG
SSSQAQAEAV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaagaagttacggatctttgcctcatgtgccctcggattatgttcagcactgg
gttcagtcagcacagcagcatctccaagccctccatgcccagtattcacatatggctaac
ggaaatgttgcccacttcatggaaggacacggagaagaacctggaatgatggaaatgcct
gtccatgagccgcctgctgcaccgctggagcctggtgctccccagcaagctcccactaaa
ggaaagaggggcagagctgcaagtaaagagcctaaagctaaaccaggtcccaagcctaag
aaggccaaggcagacaaagagggtcaaccagctgaaggaacacaggagaagattgatgag
tcctttaagaaagttaaaaggaaagtcgatcgcttcaagggcatgtctgaggaggaggtc
atgaaaaagactctgccagacatccttacatacaacctggactacgtcattattggaatc
aatccaggtttgatggctgcctacattggaagatggttccctggacctgggaaccacttt
tggaagtgcctgttcctgtctggatttactgaacagctgctgaaccacatgcacgaccag
tctctccctgagaaatacggcattggcttcactaacatggtggcaagagcaacaccggga
agcaaagatctcacaagtaaagagcttcgagaaggtggcaaaattttagtggagaagctt
aaaaagttcaaacctctcatagcagttttcaatgggaaatgtatatacgaaatgttctgt
agagagatattcgggaaaaagcccaaaactctggaatttggcttgcagccacacaagatt
cctgactcagacacggcgctgtatctgatgccctcctcaagtgcccgctgtgcccagttc
cctcgagctcaggacaaagtgcacttctacatcaagctcagagaactccgagaccaactg
aagggagtggccagacccagggaagtagaggaaatcaattacactttcgatctcggcatg
gctaaagaggatgctaagagaatggccatcaaggaggagcagtacgatcctggctacgag
gctgcgtatggaggggcgtatggagaacctggattagaggaaaacaatggccactgtgcc
ttcgcttctggagaagcagaagcagcagagaaggagcctaggaatccaaatgcagtgggc
cagcttccagatggccagtggatgaccaactccttcgctgatcagattcccgagattggc
agctcgtcacaagcgcaggcggaggccgtatga

DBGET integrated database retrieval system