KEGG   Pangasianodon hypophthalmus (striped catfish): 113546649
Entry
113546649         CDS       T05759                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04010  MAPK signaling pathway
phyp04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113546649 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    113546649 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:phyp04052]
    113546649 (kitlg)
Cytokines and growth factors [BR:phyp04052]
 Growth factors
  Growth factors (RTK binding)
   113546649 (kitlg)
SSDB
Motif
Pfam: SCF DASH_Dad4
Other DBs
NCBI-GeneID: 113546649
NCBI-ProteinID: XP_026802408
LinkDB
Position
Unknown
AA seq 287 aa
MEFRYTVEIASCFKCERKHAEAFERQCIWIRTCVHLLLYITVAAYSSEIGNPITDDIKKI
SLLKQNIPKDYKITVQYLPKEVSGMCWVKLNVFHLEESLKELAQKFGNISSNKAYIETFV
QMLREMRYIIGHSLEDSMLEFQCHYREEKWLTPRYFEFVEDFFNTANSSREVEDCEPPPC
PTTIKTKETTTAAATAAPTQHPSPPQGGSMNQRTFSVVVKRSLFSLLFIPAIAAVLLLVW
KVKSRRNTSLAQSSTEGPPLFIGAEPSAPPLDDEISENKRLNNICAV
NT seq 864 nt   +upstreamnt  +downstreamnt
atggaattcagatatactgtagaaattgcttcatgtttcaaatgtgaacgcaaacatgcg
gaagcgttcgagaggcagtgcatttggatacgtacctgtgtccatttgttgctttacatc
acagttgctgcctattccagtgaaatcggaaatcccataacagatgacatcaagaaaatt
tcattgctgaaacagaatattccaaaagactacaagatcaccgtacaatatttgcctaaa
gaagtgagtggtatgtgctgggtgaagctcaacgtatttcacttggaggagagcttaaaa
gaactggcccagaagtttgggaatatttcctccaataaagcttacatagaaacatttgtc
caaatgttacgagagatgcgatatatcattggacatagcttggaggattccatgctggag
tttcagtgccactacagagaggagaaatggctcacgccacgctattttgaatttgtggaa
gactttttcaacacagccaattcttcaagagaagtagaagactgcgaacctccgccatgc
ccaacgacgataaaaacgaaagaaacgacgacggcagcggcaacagcggcgccgacgcag
catccttcacctcctcaaggcggctccatgaatcagaggaccttttcggtggttgtgaag
aggagtctcttttcactccttttcattcctgccatcgctgccgtgttgctgctcgtctgg
aaggtgaaatccagaagaaacacctctttggcgcagagtagtacagaaggccctccgctg
tttattggagccgagcccagcgccccaccgctagatgatgaaatatctgaaaataaacga
ttaaacaacatctgtgcagtgtaa

DBGET integrated database retrieval system