KEGG   Pangasianodon hypophthalmus (striped catfish): 113546841
Entry
113546841         CDS       T05759                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04010  MAPK signaling pathway
phyp04020  Calcium signaling pathway
phyp04144  Endocytosis
phyp04510  Focal adhesion
phyp04540  Gap junction
phyp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113546841 (pdgfra)
   04020 Calcium signaling pathway
    113546841 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113546841 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113546841 (pdgfra)
   04540 Gap junction
    113546841 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113546841 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phyp01001]
    113546841 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:phyp04090]
    113546841 (pdgfra)
Enzymes [BR:phyp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     113546841 (pdgfra)
Protein kinases [BR:phyp01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   113546841 (pdgfra)
CD molecules [BR:phyp04090]
 Proteins
  113546841 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 113546841
NCBI-ProteinID: XP_026802732
LinkDB
Position
Unknown
AA seq 1465 aa
MWILKTHLLLGVVLFGILQNGACELPPPIIVSDRGEFVLELHSVFNISCTGNKSVVWEEP
LPVNTHVLPGYYTTTLLIDGAAAHHTGEYTCIYNDSDEEQPNINNMASIYIFVPDPEVPF
VPDDPTEASQFNIPCRITDPQSTVILRSLPSGDVVPYEYEEKYGFLGSFVPGQYVCETIV
NGEVVRSMVYPVTDRPNGSDMFNVMENDFSVKLTASQEEIKEGEAFNLTCTVPPGSLYVQ
KWLHPSKEAVGAIQKKETYPDKVLYILSIPHASTNDTGFYECSVTEQSSGKTHSSQVTIT
VHESSFVTLDHSGIGAVETISLLEEAEFTIYIHSDAVPKVTWFKDDNVLNTNYITAKTTL
LADKRYESVLVLRHPVEEDSGTYKILASAGSKSKEFSFKLYVKAGEPQIIQSMLAPVIWP
REETMVVFLHSMFRLTCRGQAEVVWEGPIPLDKQKLDDKRGLFVSTVTVDNAEATHTGEY
TCLYKNENQTEESSIYIFVPDPNIPFVPPPLPFGHHVLKSPEEMEVPCRVSDPSAQVTLF
HVETQQAVPATYDSKKGFLGNFTPGTYVCQALVNGEEHESEEYIVHGWTGGSGLHVEMKA
EKKALLVGETLIVNCVAKGSDLLDQQWKYPGKMADRAKMTLKENKKDQEIYYTLTVSDAR
TKDSGNYACSITDIMSNESQTKELTITVYEREFVSLAPMFAPVETAKLNDVREFQVDIEA
LPAPKVTWLKDGIVLGDTAAEFTTSLRTISETRYQSTLALIRAKAEDSGNYTVRAQIGNQ
SASHSFNLQVKVPAVIVDLMDLHHGSETGQAVVCVAGGSPVPEVEWYICKNIKQCSNDSN
EWSPLQTNTTGITIDTHIDQDNQLESQVIFGHLENTLAVRCLARNEMVAVSREIKLVANG
PHSELTVAAAVLVLLVIVIISLIVLVIIWKQKPRYEIRWRVIESVSPDGHEYIYVDPMQL
PYDTRWEFPRDGLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQA
LMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDTFLSRQGEK
GKKDLDIFGINPADESSRSYVILSFEEKGDYMDMKQADTMQYVPMLERSNASKYFDLQRD
DYDHPPSHKHINDSEVEKLLSDDSERLTTMDLLSFTYQVARGMEFLASKNCVHRDLAARN
VLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGI
LLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMAKPEHASSDVYELMVKCWNNEPEKRPSF
HSLSESVATLLPCGYKRSYERVNNDFLKSDHPAVTRVQCVQSDETYLGVAYKNQCKMRER
ESGFEEQRLSSDSGYIIPLPDLDPLSDEEYTKRNRHSSQTSEESAIETGSSSSTLPKREV
ETLEDITLLDEMCLDSGDLVEDSFL
NT seq 4398 nt   +upstreamnt  +downstreamnt
atgtggatactgaagacacatctccttttgggggttgtcctcttcggaatattgcaaaat
ggggcgtgtgaactgcctcctccgatcatcgtttcggatagaggggagttcgtgttagag
ctgcactccgtttttaacatcagctgtacagggaataagagcgtcgtgtgggaagaaccg
ctaccagttaacacacacgtgctgcccgggtattacaccactacgctgctgattgatggc
gccgcagctcatcacacgggagagtacacgtgcatttacaatgactcagatgaagagcag
ccaaacataaacaacatggccagcatctacattttcgtcccagaccctgaagttccattt
gttcctgacgatccgacagaggcctcccagtttaacattccttgccgcattacggatccg
caatctactgtgattctacggagtctaccaagtggagatgtggtcccatatgagtatgaa
gagaagtatggatttttgggctcctttgttcctggccagtacgtgtgtgagaccattgtg
aatggtgaggtggtccggagcatggtgtacccagtgacagacaggccaaatgggtcagat
atgtttaatgtgatggagaacgatttcagtgtgaaactaacagccagtcaagaggagata
aaagagggggaagctttcaacctgacctgcacggttccacctggtagtctctatgtccaa
aaatggttgcatcccagtaaagaggctgtaggtgctattcagaagaaggagacctaccct
gataaggttttgtatatcctcagtatcccacatgcctcaacgaatgacactggcttctac
gaatgctctgtcacagagcagtccagcggcaagacccactcctcccaagtgaccatcact
gtccatgagagttcttttgttactttggatcacagtgggattggagcagtagaaaccatc
tctctcctggaggaagctgaattcaccatttacatccattccgatgctgttcccaaggtc
acgtggttcaaagatgacaatgtattgaataccaattatataactgccaagaccactctt
ctagcagacaaaaggtacgagagtgttttggttctgcgacaccctgtagaagaggacagt
ggaacatataagattttagcatcagctggttcaaagagtaaagagttctccttcaaactc
tatgttaaagctggtgagccccagataatacagtccatgctggctccagtaatctggccc
agggaagagactatggtggtgttccttcactccatgtttagactgacgtgtcggggccaa
gcagaggtggtgtgggaaggtcccatcccccttgacaagcagaaattagatgacaagaga
ggcctgttcgtctccacagtgactgtggacaatgctgaggccacacacacaggagaatac
acctgtctctacaagaatgagaatcagacagaggagagcagcatctacatctttgtgcca
gatccgaacataccattcgtgccccccccactgccctttgggcaccatgtgctgaagagc
ccagaggagatggaggttccttgccgcgtgtctgatccgagtgctcaagtgacgctgttc
catgtggagactcagcaggccgtgcccgccacgtatgacagcaagaaaggttttctaggc
aacttcacacctgggacatatgtgtgtcaggcccttgtgaatggagaagagcatgagagc
gaggagtacattgtccatggctggacagggggctcagggctgcatgtagagatgaaggcg
gagaagaaagctctgctggttggggaaaccctcatagtaaactgtgtagccaaaggcagt
gacttgctggatcaacaatggaaatatcctggaaaaatggcggatcgtgctaagatgaca
ctaaaggagaacaagaaagatcaggagatctattacaccctgactgtgtctgatgccaga
actaaagacagtggaaattatgcctgttccatcactgacattatgagcaatgagagccaa
accaaagagctcaccattactgtctatgagagggagtttgtgtctctagctccaatgttt
gcccctgtggagacagccaaactgaatgatgttcgcgagttccaagtggacattgaggct
cttcctgcacccaaggtcacatggctgaaggatggcattgtactgggtgatactgctgca
gagtttactacctcccttcggacgatcagtgagacaaggtaccagagcactctcgctctg
attagagctaaggctgaggacagtggcaactacactgtgcgagctcagataggcaaccag
agcgccagccactcgttcaaccttcaggtcaaagttcctgctgtaattgtggacctgatg
gacctgcaccatggatcagaaacaggccaggctgtggtgtgtgttgccggaggatctccc
gtccctgaggtggagtggtacatctgtaaaaacattaaacagtgttccaatgactcaaac
gagtggtcacctcttcagaccaacaccactggcatcaccattgatacacacatagaccag
gacaaccagttggagagtcaggtgatctttggacatctggagaacacgctggccgtgcgc
tgtctggcacggaacgagatggtcgctgtgtcccgtgagatcaaactggtggccaatggt
ccgcactcagagctcactgtggcggctgctgttctggtgctgttggtcattgtcatcatc
tcactcattgtgctggtcattatctggaaacagaagccacgttatgagatcaggtggcgg
gtcattgagtcagtcagtccagatgggcatgagtacatctacgtggatcccatgcagctg
ccctacgacacacgctgggagtttccacgtgatggccttgtccttggccgtattctgggc
tcgggggcctttgggaaggtggtggaaggcactgcatatggactcagtcgttctcagcca
gtaatgaaggtcgcagtgaagatgctcaaaccaacggctcgctccagtgagaagcaagca
ctgatgtcagagctgaagatcatgactcacctgggcccccacctcaacattgttaacctg
ctgggtgcatgcaccaaatcaggtcctatctatatcattaccgagtactgtttttatgga
gacctggtgaactacttgcataagaacagagacaccttcctgagccgacagggtgagaag
ggcaagaaggacctggacatctttggcatcaatccagctgatgagagcagcagaagctac
gtgatcctgtcttttgaggaaaaaggagactacatggatatgaagcaagcagacacaatg
cagtatgtccccatgttggagaggagcaacgcctccaagtacttcgacctccagagagat
gattatgatcaccctccctctcacaaacacatcaatgacagtgaggtagaaaagcttctc
tctgatgactcagagcgcttgaccacaatggatcttctcagcttcacctatcaagtggcc
agagggatggagttcctggcctccaaaaattgtgttcacagagatttggcagctcgaaat
gtcctgttgtctcaggggaagattgtgaagatctgtgactttgggctggccagggacatc
atgcatgacaacaactatgtatccaaaggaagtaccttcctaccagtaaaatggatggcc
cctgagagcatctttgataacctctacaccactctgagtgacgtctggtcttacggcatt
ttactgtgggagatcttttctctgggtgggaccccttatcctggcatggttgtggactcc
agcttctataacaagatcaagagtggctacaggatggccaaacctgagcacgcctccagt
gatgtttatgagcttatggtgaagtgctggaacaatgagccagagaagagaccctcgttc
cacagtctgagtgagagtgtggccaccctgctgccatgcggatacaagaggagctatgag
cgtgtaaataatgacttcctgaagagcgaccacccggcggtgacccgcgtgcagtgtgtg
cagagcgatgagacctatttgggtgtggcctataagaaccagtgcaagatgagggagcgt
gaaagcggcttcgaagagcagagactgagctcagacagtggctacatcatccctctgcct
gatcttgaccccctttccgacgaagaatacaccaaaaggaaccgccatagctctcagaca
tctgaggagagcgctatagagacaggctcgagcagctccacccttcccaagcgggaagta
gagactctggaggacataacactgctggacgagatgtgcctggactcaggggatctggtg
gaggacagcttcctgtga

DBGET integrated database retrieval system