KEGG   Porphyrobacter sp. HT-58-2: CHX26_04475Help
Entry
CHX26_04475       CDS       T05364                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
phz  Porphyrobacter sp. HT-58-2
Brite
KEGG Orthology (KO) [BR:phz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CHX26_04475
Enzymes [BR:phz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CHX26_04475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA FAD_oxidored K_oxygenase DAO HI0933_like FAD_binding_3 Thi4 NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AUX68864
UniProt: A0A2L0GIE4
LinkDB All DBs
Position
complement(920785..922374)
Genome map
AA seq 529 aa AA seqDB search
MLDAAMQAQLKTYLGNLREGVELVASLGECEKSRQTRALIEQIASLHDLVTARFDGTDDR
KPSFVIRRESDAEKWVRFAGLPMGHEFTSLVLALLWAGGHPPKVDADLIEQVRALEGDYH
FEMFFSLSCHNCPDVVQALTLMALENPRITATLIEGGTFQSEVEARDIMAVPATFLNGEP
FYNGKMELAEILSRLDKNADAKQAEKLAAKAPFEVLVVGGGPAGAAAAVYTARKGFSTGI
AAERFGGQLMDTLGIENLPGTTYTEGPKLTDSLKAHVGEYDIDLMDLARAVELKPAKEIG
GYHEVVMANGASLRARSLILSTGARWRNLGVPGEAEYRNKGVAYCPHCDGPLFKGKRIAV
IGGGNSGVEAAIDLAGIVGHVTLIEFDVKLRADEVLQRKLRSMPNVEIITNGQTTEILGE
NGKVSGLVVKNRANGEERRIQLEGVFVQIGLVPNTEWLRETGLELSKFGEIVIDDHGATN
LPGIYAAGDCTTVPHKQIVVAMGEGAKAGLGAFDFLIRNEPVEDVAQAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatgctgccatgcaggcccagctcaagacctatctcggcaatctgcgtgaaggc
gtggaacttgtcgcctcgctcggcgaatgcgagaagtcacgccagacgcgcgcgctgatc
gaacagatcgcgtcgctgcacgatctcgtgaccgcacgcttcgacggcaccgatgatcgc
aagccgagcttcgtcatccgccgggagagtgacgcggaaaagtgggtgcggttcgcgggg
ctcccgatgggccacgaattcacctcactggtgctcgcgctgctgtgggctggcggacac
ccgcccaaggttgacgccgacctgatcgaacaggtgcgcgcgcttgagggcgattatcac
ttcgagatgttcttctcgctgtcgtgccacaactgccccgacgtggtgcaggcgctgacc
ctgatggcgctcgaaaacccgcgcatcaccgccacgttgatcgaaggcggcaccttccag
agcgaagtcgaggcgcgcgacatcatggccgtgccggcgaccttcctgaatggcgagccg
ttctacaacggcaagatggaactggccgagatcctcagccgtctcgacaagaatgccgac
gccaagcaggccgaaaagctcgccgccaaggcgccgttcgaggtgctggtggtgggcggc
ggccccgcgggcgcggcggcggcggtctacaccgcgcgcaagggcttcagcacgggcatc
gcggcggaacgcttcggcgggcagctgatggacacgctcgggatcgagaacctgcccggc
acgacctacaccgaagggccgaagctgaccgacagcctgaaggcgcacgtcggcgaatat
gacatcgacctgatggacttggcccgcgcggtcgaactcaagccggccaaggaaatcggc
ggctatcacgaggtcgtgatggccaacggcgcttcgttacgcgcccggtcactgatcctt
tccaccggcgcgcgctggcgcaatctcggcgtgccgggcgaggcggagtatcgcaacaag
ggcgtggcctattgcccgcactgcgacggcccgctgttcaagggcaagcgcatcgcggtg
atcggcggcggcaattccggggtcgaggcagcgatcgaccttgccgggattgtcggccac
gtcaccctgatcgagttcgacgtgaagctgcgcgccgacgaagtgctccagcgcaagttg
cgctctatgcccaatgtcgagatcatcaccaacggccagaccacggagatcctcggcgaa
aacggcaaggtcagcgggctggtggtcaagaaccgcgccaatggcgaggaacgccgcatc
cagctcgaaggcgtgttcgtgcagatcggcttggtgccgaacaccgaatggctgcgcgag
accggcctcgaattgtcgaagttcggtgagatcgtgatcgacgatcacggtgcgaccaac
ctgcccggcatctatgcggcaggcgattgcaccaccgtgccgcacaagcagatcgtcgtc
gccatgggcgaaggcgcgaaggcaggcctcggcgcgttcgacttcctgatccgcaacgaa
ccggtcgaggacgtggcgcaggcggcgtaa

DBGET integrated database retrieval system