KEGG   Porphyrobacter HT-58-2: CHX26_07060Help
Entry
CHX26_07060       CDS       T05364                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
phz  Porphyrobacter HT-58-2
Pathway
phz00473  D-Alanine metabolism
phz00550  Peptidoglycan biosynthesis
phz01100  Metabolic pathways
phz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:phz00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CHX26_07060
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CHX26_07060
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CHX26_07060
Enzymes [BR:phz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CHX26_07060
Peptidoglycan biosynthesis and degradation proteins [BR:phz01011]
 Precursor biosynthesis
  Amino acid ligase
   CHX26_07060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AUX69287
UniProt: A0A2L0GJR1
LinkDB All DBs
Position
1495807..1496799
Genome map
AA seq 330 aa AA seqDB search
MTVTKPLHVAVLMGGWANERQVSLTSGAGVADALESKGHRVTRIDMGRDVALRLHEAKPD
VVFNALHGVPGEDGTVQGMLDLMGLAYTHSGLATSVIAIDKQLTKQALVPHGIPMPGGRI
VTREELYQRDPLPRPYVLKPVNEGSSVGVAIVTADSNFGNPINPDAKGPWQEFAELLAEP
FIKGRELTAAVLDGPDGPRALGVTELVVANGFYDYENKYTAGRTEHIFPAKLPPEITALC
EAYAVKAHQVLGCHGTSRTDFRWDEEAGEDGLFVLETNTQPGMTPLSLVPEQAAGCGISY
ADLVEMLVAEALRGHALKQKGDTHGAADQA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcaccaaacccctccatgtcgcggttctgatgggcggctgggccaatgaacgg
caggtctcgctcaccagcggtgcaggcgtggccgatgcgctcgagagcaagggccaccgc
gtcacccgcatcgacatggggcgggacgtggcgcttcgcctgcatgaggccaagcccgat
gtcgtcttcaacgcgctccacggcgttcccggcgaggacgggacggtgcaggggatgctc
gatctgatggggctggcctatacccattcgggcctcgcgacttcggtgatcgcgatcgac
aagcagctgaccaagcaggcgctggtgccgcatggcatccccatgcccggcgggcggatc
gtgacgcgcgaggaactctaccagcgcgacccgctgccgcggccctatgtcctgaagccc
gtcaacgaagggtcgtcggtcggcgttgccatcgtcaccgcggatagcaatttcggcaac
ccgatcaacccggatgcaaaggggccgtggcaggaattcgccgaactgctcgccgaaccc
ttcatcaagggccgcgaactcactgccgccgtgctcgacggccccgacggcccacgcgca
ttgggagtcaccgaactcgtcgttgccaacggcttctacgattacgagaacaaatacacc
gccgggcgcaccgaacacatctttccggcgaaactcccgcccgaaatcaccgccctgtgc
gaggcctatgcggtcaaggcgcatcaggtgctcggctgccacggcaccagccgcaccgat
ttccgctgggacgaggaggcgggtgaggacgggttgttcgtgctcgaaaccaacacccag
cccggtatgacaccgctcagcctcgtgcctgaacaggcggcaggctgcgggatcagctat
gccgatcttgtcgagatgctggtggcagaggcgctgaggggccacgcgctgaagcagaag
ggagacacgcatggcgcagcagatcaggcgtaa

DBGET integrated database retrieval system