KEGG   Porphyrobacter sp. HT-58-2: CHX26_11030Help
Entry
CHX26_11030       CDS       T05364                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
phz  Porphyrobacter sp. HT-58-2
Pathway
phz00010  Glycolysis / Gluconeogenesis
phz00020  Citrate cycle (TCA cycle)
phz00620  Pyruvate metabolism
phz01100  Metabolic pathways
phz01110  Biosynthesis of secondary metabolites
phz01120  Microbial metabolism in diverse environments
phz01130  Biosynthesis of antibiotics
phz01200  Carbon metabolism
Module
phz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:phz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHX26_11030
   00020 Citrate cycle (TCA cycle)
    CHX26_11030
   00620 Pyruvate metabolism
    CHX26_11030
Enzymes [BR:phz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CHX26_11030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AUX69951
UniProt: A0A2L0GKY1
LinkDB All DBs
Position
2343975..2345369
Genome map
AA seq 464 aa AA seqDB search
MAIDIKMPALSPTMEEGSLARWLVKVGDTVSSGDVMAEIETDKATMEFEAVDEGVIAEIL
IEEGSEGVKVGAVIARLAVEGEEAAPAPAPAAEAAAVEGPAATPTARKLAEVNGIDLSSL
TGTGPKGKITKEDVEGAIAKSGGAPVAAPATPAPAPAAAPAASGERIIASPLAKRIAADR
GIDLALVKGTGPNGRIVKDDVENFTPAAAASQAPAATPAAPPAPVAVPTLGGDLDAPYEV
QKLNNVRKVIARRLTEAKQTIPHIYLTVDIRLDALLKLRGELNKSLEADGVKLSVNDLLI
KALARALQRVPKCNVSFQGDTLLQFTRQDISVAVAAPSGLITPIIRDAGRKGLAEISTEM
KALANKAKDGKLQPHEFQGGTASLSNLGMFGTKQFDAVINPPQAMILAVGAGEQRPWVED
GQIVPATVMSATGSFDHRAIDGADGAQLMEALKNLVENPMGLVV
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggccatcgacatcaagatgccggcactgtcgcccaccatggaagagggctcgctggcg
cgctggctggtcaaggtcggcgacacggtttcctcgggcgacgtgatggccgagatcgag
accgacaaggcgacgatggagttcgaggcggttgatgaaggcgtgatcgcggaaatcctg
atcgaagaaggctccgagggcgtaaaggtcggcgcggtgatcgcgcggcttgcggtggag
ggcgaggaagcggctcctgcgccagcacctgccgccgaagcagctgcggtggaaggcccc
gccgccacgccgaccgcgcgcaagcttgccgaagttaacggcatcgacctttcaagcctc
accggcaccggccccaagggcaagatcaccaaggaagatgtcgagggcgcaattgcgaag
agcggcggcgcgccggtcgctgcgcctgcgacgcccgcaccggctcccgcagctgctccc
gccgcatcgggcgagcgcatcatcgcctcgccgctggccaagcggatcgcggctgacagg
gggatcgacctggcgctggtgaaaggcaccggccccaatgggcggatcgtcaaggacgac
gtggagaatttcacccccgcagccgccgcgtcccaagctcccgcggcgacacctgccgcc
ccgccagcaccggtcgcagtgccaaccctcggcggcgatctcgatgcaccttacgaagtc
cagaagctcaacaatgtccgcaaggtcatcgcccgccggttgaccgaggccaagcagacc
atcccgcacatctacctcacggtcgatatccgcctcgatgccctgctcaagctgcgcggc
gaattgaacaagtcgcttgaggcggacggcgtgaagctgtcggtcaatgatctgctgatc
aaggcgctcgcccgcgcgctccagcgcgtgcccaagtgcaatgtcagcttccagggtgac
acgctgctgcaattcacccggcaggatatctcggtcgcggtggccgcgccctcgggcctc
atcaccccgataatccgcgatgccgggcgcaagggcctcgcggaaatcagcaccgagatg
aaggcgctcgcgaacaaggccaaggacggcaagctgcaaccgcacgaattccagggcggc
acggcgagcctttcgaacctcggcatgttcggcaccaagcagttcgacgcggtgatcaac
ccgccgcaggcgatgatcctcgccgtgggcgcgggcgagcagcgcccgtgggtcgaggac
ggccagatcgtccccgccaccgtcatgagcgccaccggcagcttcgatcaccgcgcgatc
gatggcgctgacggggcgcagctgatggaggcgctgaagaacctcgtggagaacccgatg
gggctggtggtctag

DBGET integrated database retrieval system