KEGG   Pseudoalteromonas issachenkonii: PI2015_0519Help
Entry
PI2015_0519       CDS       T04164                                 

Definition
(GenBank) Penicillin-binding protein 3
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
pia  Pseudoalteromonas issachenkonii
Pathway
pia00550  Peptidoglycan biosynthesis
pia01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pia00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PI2015_0519
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    PI2015_0519
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pia01011]
    PI2015_0519
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pia03036]
    PI2015_0519
Enzymes [BR:pia01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PI2015_0519
Peptidoglycan biosynthesis and degradation proteins [BR:pia01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   PI2015_0519
Chromosome and associated proteins [BR:pia03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    PI2015_0519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer Rbsn
Motif
Other DBs
NCBI-ProteinID: ALQ53841
UniProt: A0A290SCQ8
LinkDB All DBs
Position
I:569127..570944
Genome map
AA seq 605 aa AA seqDB search
MRMRGKKPVNNLIAWRFILVCAVIFLVFVTLVSRAAYLQVIEPDKARSESDKRTVRIEKL
HVQRGMIFDRNGKELAVSVPVVSVYADPKALHKSLVSKVLRQARKNGEDQQTLRENVAEL
NKRTALYYKNDLRWRELADVLRIEPSKINTRLLDDPTRRFVYLKRQVTPAVANYIGDLRL
PGIHLLDESKRYYPAGEVSAHVIGFTNIDGKGIEGIEKLYENALTGEEGRRTIRKDAQGR
EVEVLDERERVEPESIQLSIDQRIQAIAYKAVKSAVLTYKATSGSAMVVDVKTGEVLAMV
NSPSFNPNNLSGAAPHKRRNRAITDLFEPGSTVKPLAILAGLDYGTIQPDDKVDTYPGWM
RLGGSLVQDTRNHGEMTLREILKYSSNMGVTKISQTVPKEYFVGLYQKVGFGSDSGTGMV
GESSGLFYPNRRWSDHEIAALSFGYNIAVSTAQMARFYAMLGAGGVNRPLTVLKQDSIPE
GERVFQQEDVEAVVHMMESVFEEGGTARRVKVDGYRAAGKTGTSKKAAAGGYGDEYVGYF
AGIAPASNPRLAVVVLINEPGGDVYYGGATAGPAFAEIISNSLRILNVAPDKDSVAYVKG
KDDGA
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgcgaggcaaaaaaccagtcaataacctaatagcatggcgctttattttagtg
tgcgcggtgatttttttagtgtttgtgaccttggtatcgcgtgctgcgtacttgcaagta
attgaacctgataaagcgcgctctgaaagcgataaacgtacggtacggattgaaaaactg
catgtgcaacgcgggatgattttcgatcgtaacggtaaagagcttgccgttagtgtgcct
gtggtaagcgtgtatgcggatcctaaagccctgcataaatcactggttagtaaagtactt
aggcaagcacgcaaaaacggtgaagatcagcaaacgcttcgtgaaaatgttgctgagtta
aataagcgtaccgccctgtattataaaaatgatttacgctggcgtgaattggctgatgtg
ttacgcattgagcctagtaaaattaacacgcgattacttgatgatcctactcgtcgcttt
gtgtatttaaaacgccaagtgactcccgctgtggctaattacatcggtgatttacgccta
cctggtattcatttattggatgaatcaaaacgttattaccctgctggtgaagtaagcgca
catgttattgggtttaccaatattgatggtaaaggcattgagggcatagaaaagctttat
gaaaacgcgttaaccggtgaagaaggtcgccgtaccattcgcaaagatgcgcaagggcgt
gaagttgaagtgcttgatgaacgcgagcgagtagagcctgaaagcattcagctaagtatt
gatcagcgaattcaagccattgcctataaagcagttaaatcagcggtattaacttataaa
gcgacctcaggttctgccatggtagtagatgttaaaaccggtgaagtcttggccatggtc
aatagcccatcatttaatcctaacaacttaagcggggcggctcctcataaacgtcgtaac
cgcgctattaccgatttgtttgaacccggctcaactgttaagcctctagccattttagct
ggattagactacggcacaatccaaccggatgataaagttgatacctacccaggctggatg
cgcttagggggcagcttagtacaagatacccgtaatcatggcgaaatgacgctgcgcgaa
attttaaaatactccagtaatatgggagtaaccaaaataagccaaacagtacccaaagag
tactttgtgggcctgtatcaaaaagtggggtttggcagtgatagtggtactggcatggta
ggcgaaagtagtggcttattttaccctaatcgccgttggtcagatcacgaaattgcagcg
ctctcgtttggttacaatattgccgtgagtaccgcgcaaatggcacgtttttacgccatg
ttaggggcaggcggggttaatcgtccgcttactgtactaaagcaagattctatacctgaa
ggtgagcgtgtctttcaacaagaagatgttgaagccgttgtccatatgatggaaagcgta
tttgaagaaggcggtaccgcacgccgcgttaaagtggatggttaccgcgctgctggtaaa
acaggcacctctaaaaaagccgccgcagggggctatggtgacgaatatgtaggttatttt
gcgggcattgcccctgcgagtaacccgcgattagccgttgtggtattaatcaacgagccc
ggtggagatgtttattatggcggcgcaacagcaggtccagcgtttgcagaaataatctct
aattcattaagaattttaaacgttgccccagacaaagactcggtggcatacgtgaagggc
aaagatgatggtgcgtga

DBGET integrated database retrieval system