KEGG   Pseudoalteromonas issachenkonii: PI2015_0527Help
Entry
PI2015_0527       CDS       T04164                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pia  Pseudoalteromonas issachenkonii
Pathway
pia00473  D-Alanine metabolism
pia00550  Peptidoglycan biosynthesis
pia01100  Metabolic pathways
pia01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pia00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PI2015_0527
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PI2015_0527
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PI2015_0527
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pia01011]
    PI2015_0527
Enzymes [BR:pia01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PI2015_0527
Peptidoglycan biosynthesis and degradation proteins [BR:pia01011]
 Precursor biosynthesis
  Amino acid ligase
   PI2015_0527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 RimK GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ALQ53849
UniProt: A0A290SEN9
LinkDB All DBs
Position
I:579905..580825
Genome map
AA seq 306 aa AA seqDB search
MTQVNTQFGKVAVLLGGNSAEREVSLRSGQAVLNALQNSGIDAIAFDPQSRSLWELKELN
VDRVFIALHGRGGEDGTVQGALEFMDLPYTGSNVLGSALAMDKVRCKHLFKSAGLSTAPY
TVVDAKKGFDAAAIMDEFKKVMVKPSHEGSSIGMAQASTTQELEDALANAFKFDNQVLVE
QWITGREFTITVLGDDVQPVIEMTTPNGFYDYQAKYQSNTTQYHCPADLSEQDTKYLQAI
SLDAFDLVGASGWGRVDAMQDEQGNFYLLEVNTVPGMTEKSLVPMAAKANGATFEQLVVR
ILEQTL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggtaaacacacaatttggtaaagtagcggtactgctaggtggtaactcagca
gagcgtgaagtgtctttacgatcgggtcaggctgttttaaatgcgctgcaaaatagtggt
attgatgcaattgcatttgacccacaaagtcgttctttgtgggagttaaaagaattaaat
gtagatcgcgtttttatcgctttgcatggccgtggtggcgaagacggcacagtgcaggga
gcacttgaatttatggacttgccttacacgggcagtaatgtactaggttcagcacttgct
atggataaagtacgttgtaagcacttatttaaatcagcgggtttaagcactgcaccttat
accgtagttgatgctaaaaaaggctttgatgctgcagccattatggatgaatttaaaaag
gtcatggttaagccatcgcatgaaggttcaagcataggtatggcgcaagcaagtacaaca
caagagcttgaagatgcactagctaatgcatttaagtttgataaccaagtacttgtagag
cagtggatcactggtcgtgagtttacaatcacagtgcttggcgacgatgtacaaccagtc
attgagatgacgacacctaatggcttttacgattaccaagctaagtatcaatcaaataca
acccagtatcattgccctgcagatttatcagagcaagatactaagtacttacaagccata
tcgctagatgcgtttgatttagtgggtgcaagtggttggggtcgtgttgatgctatgcaa
gacgagcaagggaatttttacctgcttgaagtaaatacagtaccaggcatgactgaaaag
tcactagtaccgatggctgcaaaagcgaacggggcaacttttgaacaattagttgttcgc
attttggagcaaaccctttaa

DBGET integrated database retrieval system