KEGG   Pseudoalteromonas issachenkonii: PI2015_0774Help
Entry
PI2015_0774       CDS       T04164                                 

Definition
(GenBank) Cysteine sulfinic acid decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pia  Pseudoalteromonas issachenkonii
Pathway
pia00250  Alanine, aspartate and glutamate metabolism
pia00410  beta-Alanine metabolism
pia00430  Taurine and hypotaurine metabolism
pia00650  Butanoate metabolism
pia01100  Metabolic pathways
pia01110  Biosynthesis of secondary metabolites
pia01120  Microbial metabolism in diverse environments
pia02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PI2015_0774
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PI2015_0774
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PI2015_0774
   00430 Taurine and hypotaurine metabolism
    PI2015_0774
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PI2015_0774
Enzymes [BR:pia01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PI2015_0774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ALQ54091
UniProt: A0A290SJA1
LinkDB All DBs
Position
I:858380..860005
Genome map
AA seq 541 aa AA seqDB search
MDQKRCAVASKESLKRIFTVPEAPDSTLSKIELEISSNLAGFLNENIAAIEKPLHEIEKD
FQSAAIPEEPTFVSCYAQDIMEQLVAHSVHTAAPSFIGHMTSALPHFLLPLSKLMVGLNQ
NLVKIETSKAFTPLERQVLGMMHHLAYGQSDGFYSKWMHSAKTSLGAFCSGGTVANITAL
WIARNRLLKADGNFKGIAAQGLVAGMLHYGYKGLAVLISERGHYSLGKSVDLLGIGRENL
IGIKTSADNKVDVSAMREKALELEAQGIKVMAIIGVAGTTETGNIDPLEDMANLAQEINC
HFHVDAAWGGATLLSNTHRHLLKGIEHADSITIDAHKQMYVPMGAGLVLFKDPAATDAIE
HHAEYILRKGSKDLGSHTLEGSRPGMAMLVHACLRVIGRKGYEMLIDRSIKKARYFADLI
KADEDFELISEPELCLLTYRYVPKQIKHAIAQADAQTRLDIFAALNRFTASMQKRQRESG
RSFVSRTRLTPVQYDNQPTVVFRVVLANPLTSGAILKEILEEQKELAQTDPVFKKYLRKY
M
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaagcgttgtgccgtcgcctctaaagaaagccttaaacggatattcaccgtt
ccagaggcgccagactcaactttgagcaaaatagagcttgaaatttcgagtaatttagca
ggtttcttaaacgaaaatatcgcggcaattgaaaaaccattacatgaaatagaaaaagat
tttcaatcggcggcaatccctgaagaaccgacgtttgtgtcttgctatgctcaagatatt
atggagcagctggttgctcattctgttcataccgcagcgccaagctttattggccatatg
acatcggctctgcctcattttttactaccgttatcgaaattaatggttgggttaaatcaa
aacctagtaaaaattgaaacctcgaaagcgtttaccccattagaacgtcaagttttaggg
atgatgcatcatttagcttatggccaaagtgatggtttttattctaaatggatgcacagt
gcaaaaacctcgttaggtgcattttgctctggcggcaccgtggcaaatattactgcactt
tggatagctcgaaaccgtttattaaaagcggatggcaattttaaaggtattgctgcacaa
ggtttagttgcaggaatgcttcactatggttacaaagggctggcagttttaatttctgaa
cgaggtcattattcgcttggtaaatcggttgatttattaggtattggtcgtgaaaattta
attggtattaaaacttctgccgataataaagtcgatgttagtgcaatgcgagaaaaagcg
ttagagcttgaagcacaaggcattaaagtgatggcaattattggagtcgcaggaaccact
gaaaccggtaatattgacccacttgaagatatggctaatttagcacaagagattaattgt
cattttcatgttgatgcagcgtggggtggagctactttactgtctaatacccataggcat
ttattaaaaggtattgagcatgcagattcaatcaccattgatgcgcataagcaaatgtat
gtgccgatgggggccggtttagtcttatttaaagaccctgctgcaactgatgccatcgag
catcatgctgaatatattttacgtaaaggctctaaagatttaggcagccatacgcttgag
ggaagtcgccctgggatggcgatgttagtgcatgcttgtttacgtgttattggtcgtaaa
ggctatgaaatgcttatcgatcgcagtattaaaaaagcgcgttattttgctgatttaata
aaagccgatgaagattttgagttaatatcagagccagaactttgcttactgacctatcgc
tatgtaccaaaacaaattaaacatgcgatagcccaagctgatgcacaaacccgtttagac
atttttgccgcgcttaatcgttttactgccagcatgcaaaaacgccaacgtgaatcgggt
cgctcatttgtatcgcgtacgcgtttaacgccagttcaatatgataaccaaccaaccgtg
gtatttagagtggtacttgcgaacccgcttacctcaggtgctatattaaaagagatatta
gaagagcagaaagaactggcacaaactgatccggtgtttaaaaagtatttacgaaaatat
atgtaa

DBGET integrated database retrieval system