KEGG   Pseudoalteromonas issachenkonii: PI2015_1341Help
Entry
PI2015_1341       CDS       T04164                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
pia  Pseudoalteromonas issachenkonii
Pathway
pia00500  Starch and sucrose metabolism
pia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PI2015_1341
Enzymes [BR:pia01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PI2015_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 Asp_protease
Motif
Other DBs
NCBI-ProteinID: ALQ54649
UniProt: A0A290SDN6
LinkDB All DBs
Position
I:1507855..1510260
Genome map
AA seq 801 aa AA seqDB search
MKKYNLITATILAAGLVGCGVQNTQTSAVAKTSVSAPGAPGEAPFWAYAGKTGIGTSFEQ
YQNGHYSDEAPTGKVSKVWFSIAKGMITETMFGLIHQAQIKDMQFVVVGKDFTVTEADDL
DVTIDYLYKDDKGRPLSLAYKVVSKDKQGRFSLEKHIFTDPDGQSLFVRSIFNTQLDGVK
AYVTVNPYINNNGLDDFAKTTEQGLVAWQGDNYLSLQGAQPFKQTSVGFTGVSDGLSQLK
TTQQLTRVYKTTGEQSGNVSLLAELGEIGENSQFDLTLSFGNNQQSSFKQGQATLAKGYQ
AVLDNYNGKGEALGWQDYLQSLAPLNNMSEQTADNGKLLYTSAMVLKAQEDKTHAGALIA
SLSNPWGETVSAKTGSTGYKAVWVRDFYQVAMAFMALGDTATAKTAFEYLEKVQVNSKTP
GNNGDTGWFLQKTHVDGELEWVGVQLDQTAMPIMLAWKLHQADVLSDAELTDWYTRMLKP
AADFLVDGGRAKILWNDMQITPPATQQERWEEQEGYSPSTTAAVIAGLITAADIAKMAGD
EVNAKRYLATAKSYNADIESMMFTTAGNLESNASDGEYFIRIGQDKDANSNTKINANNGR
EGFNKKQILDGGFLELVRYGVRDALAPSIVKTLPEYDDETLTDNLQVKYSFEFTDGSGTF
AGYRRYGNDGYGEDEVTGANYAQGGKNSPGQRGRVWPFFTGERGHYEIAAANANNTLDAT
KQQAIKNSYVKGLEQFANEGMMLPEQVWDGVGVNKAVYTLGEGTNSATPLAWTHAEYVKL
VRSLSDKQVWDHYPVVTKALK
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatataacctaattaccgcgacaatattggccgcaggccttgtaggttgtggc
gtgcaaaatacgcaaaccagtgcagtagcaaaaacatcagtgagtgcgccaggcgcacca
ggcgaagccccattttgggcatacgcaggcaaaactgggataggcacgtcttttgagcaa
taccaaaatggccattacagtgacgaagcacctacaggtaaagtgtcaaaagtatggttt
tcgattgccaaagggatgatcaccgaaaccatgttcgggcttattcatcaagcgcaaatt
aaagacatgcaatttgttgtagtcggaaaagattttacagtcaccgaagctgacgattta
gacgttaccattgattacttatacaaagacgataaaggccgcccgttatcattagcatac
aaagtagtaagcaaagataagcaaggtcgctttagcctcgaaaaacatatatttaccgac
ccagacggtcaaagcttatttgtacgcagtatttttaatacccagcttgacggtgtaaaa
gcatatgtaacagttaacccgtatataaacaacaacggcttagatgactttgcaaaaacc
accgagcaaggattggtagcgtggcagggcgataattacttgtcattgcaaggtgcacag
ccatttaaacaaacaagtgttggttttacaggtgtgagcgatggtttaagccagcttaaa
acaactcagcagcttacccgagtttataaaactaccggtgaacaatcgggtaatgttagc
ctacttgcagagctgggtgaaattggtgaaaacagccagttcgatttaaccttaagcttt
ggtaacaaccagcaatcaagctttaaacaagggcaagctacgcttgccaaaggttaccaa
gctgtgcttgataattacaacggtaaaggcgaagcgcttggttggcaagactacctgcaa
agccttgcaccgctaaacaacatgagcgaacaaaccgctgataacggcaagttactttac
accagtgctatggtgttaaaagcgcaagaagacaaaactcatgctggggcacttattgcc
tctttatctaacccatggggtgaaaccgtatcggcgaaaaccggctctaccggttacaaa
gcggtatgggtgcgcgacttttatcaagttgccatggcatttatggcactaggcgatacc
gcaacagctaaaaccgcatttgaatacctggaaaaagtacaagtaaacagcaaaaccccg
ggcaacaacggcgacacaggttggtttttacaaaaaacgcacgtagatggcgaacttgaa
tgggtaggcgtacagctagaccaaaccgctatgcctattatgctagcgtggaagcttcat
caggcagatgtgttaagtgatgctgagctaactgattggtatacccgcatgttaaaaccg
gccgctgactttttggtagacggtgggcgcgctaaaatcctatggaacgacatgcaaata
accccacctgcgactcaacaagagcgttgggaagagcaagaagggtattcgccatcaacc
accgctgctgttattgccggtttaattaccgccgctgatattgcaaaaatggcaggagat
gaggtgaatgctaaacgctaccttgcaacagcaaaaagttacaacgccgatatagaaagt
atgatgtttaccaccgcaggtaatttagaatcaaacgcttcagacggcgagtattttata
cgtattggtcaagacaaagacgccaattcaaatactaaaattaacgctaataatggccgt
gaagggtttaataaaaagcaaatacttgatggtggctttttagagttggttcgctatggc
gtacgtgatgcgctagcgcctagcatagtaaaaacactgccagagtatgatgacgaaacc
ctaacagataacttacaagttaaatacagctttgagtttacagatggtagcggcacattt
gcaggctaccgccgttatggtaacgacggctacggtgaagacgaagtaactggcgctaat
tatgcgcaaggtggaaaaaatagcccagggcaacgtgggcgagtttggccattttttacc
ggtgaacgaggtcattacgaaattgccgccgcgaatgccaataatacgttagatgcaact
aaacagcaggctattaaaaatagctatgtaaaagggctagagcaatttgctaacgaaggt
atgatgctaccagaacaagtatgggatggcgtaggcgttaataaagcggtttacacgtta
ggcgagggtacaaactcggccacaccactggcgtggacacatgcggaatacgtaaagcta
gtgcgctcattaagcgacaaacaagtatgggatcattacccggtggtaactaaagcacta
aaataa

DBGET integrated database retrieval system