KEGG   Pseudoalteromonas issachenkonii: PI2015_1754Help
Entry
PI2015_1754       CDS       T04164                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pia  Pseudoalteromonas issachenkonii
Brite
Enzymes [BR:pia01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PI2015_1754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ALQ55048
UniProt: A0A290SE71
LinkDB All DBs
Position
I:1957904..1958485
Genome map
AA seq 193 aa AA seqDB search
MAFELPSLPYAIDALEPHISQETLEFHHGKHHNTYVTKLNGLIPGTEFEGKSLEEIVCSS
EGGVFNNAAQIWNHTFYWNSLSPNGGGAPTGAIADAINAKWGSFDAFKDALNDKAVNNFG
SSWTWLVKLADGSLDIVNTSNAATPLTDAGVTPILTVDLWEHAYYIDYRNVRPDYLKGFW
SLVNWEFANANFA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaactaccgtcactaccgtatgcaattgatgcacttgagccacatatttca
caagaaacgttagagtttcaccatggtaaacaccacaacacttatgtgactaaacttaac
ggtttaatcccaggcactgagtttgaaggtaaatcacttgaagagatcgtatgttcttca
gaaggcggtgtatttaacaacgctgctcaaatctggaaccacactttctactggaacagc
ctatctccaaatggcggtggcgctccaacaggtgcaattgctgatgcaattaacgctaaa
tggggctcatttgacgcatttaaagacgcgttaaacgacaaagcagtaaataactttggt
tcaagctggacttggttagttaaactagctgatggttcactagacatcgttaatacatct
aacgctgcaacaccattaacagatgcaggtgttacaccaatcctaaccgtggatttatgg
gaacacgcatactatattgattaccgtaacgtgcgtccagattaccttaaaggtttctgg
tcactcgttaactgggaattcgcgaacgctaacttcgcataa

DBGET integrated database retrieval system