KEGG   Pseudoalteromonas issachenkonii: PI2015_2330Help
Entry
PI2015_2330       CDS       T04164                                 

Definition
(GenBank) Ribose-5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
pia  Pseudoalteromonas issachenkonii
Pathway
pia00030  Pentose phosphate pathway
pia01100  Metabolic pathways
pia01110  Biosynthesis of secondary metabolites
pia01120  Microbial metabolism in diverse environments
pia01130  Biosynthesis of antibiotics
pia01200  Carbon metabolism
pia01230  Biosynthesis of amino acids
Module
pia_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pia_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:pia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PI2015_2330
Enzymes [BR:pia01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     PI2015_2330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind
Motif
Other DBs
NCBI-ProteinID: ALQ55606
UniProt: A0A290SG35
LinkDB All DBs
Position
I:2590910..2591563
Genome map
AA seq 217 aa AA seqDB search
MTQDELKKAAAWAALEFVKENTIVGVGTGSTVNHFIDALGTVKDTIVGAVSSSEASTARL
KELGIEVFELNDVDALDVYVDGADEINALNEMIKGGGAALTREKIVAAVAKQFVCIVDDT
KLVDTLGDFPLPVEVIPMARSYVARELLKLGGDPVYRQGVVTDNGNVILDVHNLKITHAK
QLETQINQIVGVVTNGLFAERGADKVIIGTKNGPQIK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagatgaattaaaaaaagcagctgcatgggctgcactggagtttgtaaaagaa
aacaccatagtgggtgttggtacaggctcaaccgttaatcattttattgatgctttaggc
acagtaaaagacaccatcgttggtgcagtatctagttcagaagcgtctacagcacgttta
aaagaacttggtatagaagtatttgagctaaatgatgttgatgctctggatgtatacgtt
gatggcgcagatgaaattaacgctctaaacgaaatgattaaaggcggtggtgcagcgctc
acccgtgaaaaaatagtagcggcagtggctaaacagtttgtgtgtattgttgatgacacc
aaactagtcgataccttaggggatttcccgctgccagttgaagttattccgatggcgcgc
agctatgttgcccgcgaattattaaaacttggcggtgaccctgtgtatcgccaaggtgtt
gtaaccgataacggcaacgttattttagatgtacataatttaaaaattacccatgctaaa
cagcttgaaacacaaataaatcaaattgttggcgtagtcaccaacggcctatttgcagag
cgcggtgctgataaagtgattatcggcacaaaaaatgggccacaaattaaatag

DBGET integrated database retrieval system