KEGG   Pseudoalteromonas issachenkonii: PI2015_3364Help
Entry
PI2015_3364       CDS       T04164                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pia  Pseudoalteromonas issachenkonii
Brite
KEGG Orthology (KO) [BR:pia00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PI2015_3364
Enzymes [BR:pia01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PI2015_3364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 DAO FAD_oxidored Thi4 NAD_binding_9 NAD_binding_8 FAD_binding_3 Glutaredoxin K_oxygenase FMO-like Thioredoxin_9 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ALQ56606
UniProt: A0A290SLR9
LinkDB All DBs
Position
II:396828..398405
Genome map
AA seq 525 aa AA seqDB search
MLDNNIKNQLKSHFESLTQPVELLIALDDSKKSTEVESLANDLASLSDKFSVINNPDTSA
RRPSMVVHSPEKNTHITFAGVPMGHEFTSLVLALLHTGGHPSKASKDDIEQIQTLEQTLN
FEVYISLSCQTCPQVVQALNTMAATNSNIKATMIDGALFQDEVEQRNILAVPAVYLNGEP
FSQGAMSLTDILNKVDSKGAQRQAASLNEKSVFDVLVVGGGPAGASAAIYSARKGLNTGV
VAERFGGQVADTLAIENFISIKATQGPKMVAQLEEHVKEYDVDVIHNQRAANLQKGSNGY
DITLENGAVLKAKSLVLATGARWREMNVPGEQQYKGHGVAYCPHCDGPLFKGKPVAVIGG
GNSGIEAAIDLANIVEHVTVLEFADTLRADEVLIRKANSLKNITIIKNAQTTEVLGDGKK
VTGLSYTDRLSGESKQLNLAGIFVQIGLIPNTEWLKDSDLELSQFGEILIDAKGATSLQG
VYAAGDATTTPFKQIIIAMGAGATASLGAFDYLIRQTPDAEQSAA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgttagacaacaacataaagaaccaactaaaaagccattttgaatcgctgactcagcct
gttgagctgcttatcgccttggacgacagcaaaaaatcaacagaagtagaaagtctagca
aacgatttagcgtcactaagcgataagtttagtgtaataaataatcccgatactagcgcc
cgcaggccttctatggtggtgcattcaccagaaaaaaatacccatattacctttgcaggt
gtacctatggggcacgaatttactagcttagtgttagcgctattacatacgggtggtcac
cctagtaaagcaagtaaagatgacattgaacaaatacaaacacttgagcaaacacttaat
tttgaagtgtacattagcttgagttgccaaacctgcccgcaagttgtgcaggcacttaat
actatggcagcaacaaatagcaatattaaagccaccatgattgatggggcattatttcaa
gatgaagtagagcaaagaaacatactggctgtacccgctgtatatttaaatggtgaaccc
tttagccaaggggccatgagcctcactgatattttaaataaagtggatagcaaaggtgca
cagcgccaagcagcatcactcaatgaaaagtcggtgtttgatgtacttgtcgtcggtggt
gggccagctggtgcttcggcagctatttattcagcacgtaaagggctcaatactggggtt
gtagcagagcgatttggcggtcaagttgctgatacattagcgattgaaaactttatttca
ataaaagcaacgcaagggccaaaaatggtggctcagttggaagaacacgttaaagaatac
gatgttgatgttatacacaaccaacgcgcggcaaacctgcaaaaaggcagtaatgggtat
gatattactttagaaaatggcgctgtattaaaagcaaaatcactcgtactagcaaccggt
gcacgctggcgcgaaatgaatgtacccggtgagcaacagtataaaggccatggcgttgca
tactgcccgcactgtgatgggcctctatttaaaggtaaaccggttgcggttattggtggt
ggtaattcaggtattgaggcggcaattgatttagccaatatagttgaacacgttactgtg
cttgaatttgctgatacgttacgcgccgatgaggtacttattcgtaaagctaatagctta
aaaaacatcactattattaaaaacgcccaaaccacggaagtacttggtgatggcaaaaaa
gtaacggggttaagttataccgaccgccttagcggcgagagtaaacagttgaacttagcc
ggtatatttgtacaaattggtttaatacctaataccgaatggttgaaagacagcgacctt
gaactgagccaatttggtgaaatactcattgatgccaaaggcgcaacatcgttacaaggc
gtttatgctgcaggtgatgcaaccactacgccatttaagcaaattattattgcgatgggg
gcgggcgcaacagcaagcctaggtgcgtttgactatttaattcgtcaaacgcccgatgca
gagcaaagcgctgcttaa

DBGET integrated database retrieval system