KEGG   Paenibacillus ihbetae: BBD41_16405Help
Entry
BBD41_16405       CDS       T05154                                 

Definition
(GenBank) F0F1 ATP synthase subunit epsilon
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
pib  Paenibacillus ihbetae
Pathway
pib00190  Oxidative phosphorylation
pib01100  Metabolic pathways
Module
pib_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:pib00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BBD41_16405
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:pib00194]
    BBD41_16405
Photosynthesis proteins [BR:pib00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BBD41_16405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_DE_N ATP-synt_DE UreE_C
Motif
Other DBs
NCBI-ProteinID: ANY74033
UniProt: A0A1B2E245
LinkDB All DBs
Position
3740150..3740554
Genome map
AA seq 134 aa AA seqDB search
MSTFLLEIVTPDRVVYSEQVNSVTVRGVEGELGILPGHIPFVTPLQIAPVYVKIGNERTP
FAVQGGFVEVRKDKVVILAESAERASEIDRERAEAAKERAQARLNAKGRQDEIDHRRAEL
ALQRAMNRIKVTQG
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacctttttgttggaaatcgtaacaccggaccgcgtcgtttattccgagcaagtg
aacagtgttacggtgcgcggggtagaaggggagctgggcattttgcctgggcatattcct
ttcgtaacgcctcttcagatagctcccgtctatgtgaagatcggcaatgaacgcaccccg
tttgcggtacaaggcgggttcgtcgaagtccgcaaagataaggttgtcatcctggctgaa
agcgccgagcgagcgagtgaaatcgatcgggagcgtgcagaagccgcgaaagagcgcgcg
caagcccgcttgaacgccaaaggaagacaggacgaaatcgaccatcgccgcgcagagctc
gctctgcaaagagcgatgaaccggattaaggtaacccaaggctaa

DBGET integrated database retrieval system