KEGG   Paenibacillus ihbetae: BBD41_17650Help
Entry
BBD41_17650       CDS       T05154                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pib  Paenibacillus ihbetae
Pathway
pib00620  Pyruvate metabolism
pib00680  Methane metabolism
pib01100  Metabolic pathways
pib01120  Microbial metabolism in diverse environments
pib01200  Carbon metabolism
Module
pib_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pib00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBD41_17650
  09102 Energy metabolism
   00680 Methane metabolism
    BBD41_17650
Enzymes [BR:pib01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BBD41_17650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 ING
Motif
Other DBs
NCBI-ProteinID: ANY74250
UniProt: A0A1B2E2N7
LinkDB All DBs
Position
4017323..4020109
Genome map
AA seq 928 aa AA seqDB search
MTELTVTAKSNSNNLLRRDVRFLGNILGEVLVHQGGNELLDIVEKIRETSKSLRSVFLPE
LFADFKRIISTLEPDIRHQVIRAFAIYFQLVNIAEQNHRIRRKRDYERSAGEGVQPGSIE
SAVQDLKERNIPFEEVQEILENLSLELVMTAHPTEAMRRAILDIHKRIAEDVMLLDNPTL
TFREREQLREKLLNEVITLWQTDELRDRKPTVLDEVRNGMYYFHETLFHILPEVYQELER
CLNKYYPGHHWHVPTYLRFGSWIGGDRDGNPSVTADVTWKTLEMQRKLAIREYQRILRDF
MKYLSFSSTIVNVSDELIASIEKDRQNVTLKKMEIWHNEKEPYRIKLVYMLAKISHILDD
DMTGSERYQSPEEFIEDLKIIDRSLRFHFADYVADTYIQKLIRQVELFGFHTATLDIRQH
SKEHENAMAEILHKMNVTSDYVQLSEDEKIALLNDLLNDPRPLTTPYQEYSDSTEECLEV
YRTVFRAQKEFGVKCISSYLISMSEGASDILEVMVFAKEAGLFRKDTDGTVVATLQAAPL
FETIEDLHAAPEIMRKLFNLPIYREAVSAMNDLQEIMLGYSDSNKDGGAITANWELQVAL
KEITAVANEYGIKVKYFHGRGGSLGRGGMPLNRSILAQPASTIAGGIKITEQGEVISSRY
SLKGIAYRSLEQATSALITASINARYPETQSVDKEWEDIASRISEAAQKKYQDLIFRDPD
FLTFFKESTPLPEVGELNIGSRPSKRKNSDRFEDLRAIPWVFAWTQSRYLLPAWYAAGTG
IQSFYQGKEENLKVLQKMYTDYPFFTSLIDTLQMALAKADLIIAKEYSLMTKDDTSRERI
FGMIQEEFNLTKDLVLKITGQQDILDNQPVLQESIRLRNPYVDPLSYLQVQLLNELRSLR
EQGQDDAELLREVLLTINGIAAGLRNTG
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacttacagtaaccgcaaagagtaattccaacaatctgctgcggcgagatgta
cggttccttggcaatattcttggagaagttctggtccaccaaggtggcaacgagcttcta
gatatagttgagaaaattcgcgaaacgagcaaatcgttgcgatccgtatttcttcctgaa
ttgttcgcagattttaaaagaatcatcagcacgctggaaccggacattcgccatcaggtg
atccgcgcatttgcgatttacttccaattggttaacatcgcagagcagaatcaccgcatc
cgccggaaacgcgattatgagcgctccgctggtgaaggcgttcagccgggatccattgaa
agtgcggtccaggatctgaaagaacgcaacatcccttttgaagaagttcaagaaattctc
gaaaatctatcccttgagctggtcatgacagctcaccctactgaagcgatgcgcagagcc
attctcgacatccataaacggatcgccgaggatgtgatgctgctagacaacccaacatta
acattccgcgaaagagaacagcttcgggagaagcttctgaatgaagtaatcacgctgtgg
caaaccgatgagcttcgcgaccgtaagccgaccgttctggatgaggttcgtaacggaatg
tattatttccatgaaacactgtttcacattctgccagaggtttatcaagagctggagcgt
tgcctgaacaagtactatccgggccaccattggcatgttccgacgtatctgcgtttcgga
tcgtggatcggcggagaccgggacggtaatccttcggtgacggcggacgtgacctggaaa
acccttgagatgcagcgtaaattggccatccgtgaataccaacggatcctgcgagatttc
atgaagtatctcagcttcagctcgaccattgtcaacgtatccgacgagttgattgcatcc
attgagaaggaccgccaaaacgtcacgctgaagaagatggaaatttggcacaatgagaaa
gagccgtatcggattaaactcgtatatatgctcgccaaaatcagccatattctcgatgac
gacatgaccggcagcgagcgctaccagtcaccggaggaattcattgaggatttgaagatc
atcgaccgcagcctgcgtttccattttgccgactatgtcgccgatacgtatatccagaag
ctgattcgccaggtcgagttgtttggcttccataccgcaaccctggatataagacagcac
agcaaagagcatgagaatgcaatggctgagattttgcacaaaatgaacgtgaccagtgat
tacgtgcaattaagcgaagatgagaaaattgcgctgctgaacgacctgctgaatgacccg
cgtccgctgacgaccccttatcaggagtacagcgacagcacggaggagtgcctggaagtg
taccgcaccgttttccgcgcacagaaggaattcggcgtgaagtgcatttcgagttatctg
atcagtatgtcggagggtgcaagcgatattctggaagtaatggtgtttgcgaaggaagcc
ggattgttccgcaaggatacggacggtacggttgttgccaccttgcaggcagcgccgttg
ttcgagacgatcgaggacctgcacgcggcgcctgagatcatgcgtaagctcttcaacctt
ccgatctatcgggaggccgtaagcgcaatgaacgacctgcaggagatcatgctcggctac
tctgacagcaacaaggacggcggagccattacagccaactgggagcttcaggtggcgctt
aaggaaattaccgcggttgccaatgagtacggcatcaaggtgaagtatttccatggtcgc
ggcggatccttgggacgcggcggcatgccgctgaaccgcagtattctggcacaaccggcg
tccacgattgccggcggcatcaagattacggagcagggcgaggtcatctcgtcacgctat
tccctgaagggaattgcatatcgaagcctggaacaagccacttcggcgctcattacggca
tcgatcaatgctcgttatcctgaaactcaatccgtcgataaagaatgggaggacatcgca
tcccggatctcggaggcagcgcagaagaagtatcaggatctgatcttccgtgacccggat
ttcctcaccttcttcaaggaatcgactccgcttccggaagtgggcgagcttaatatcggt
tcccgtccatcgaagcgaaagaacagcgaccgttttgaggacctcagagccattccatgg
gtgtttgcatggacccagagccgttacctccttccggcatggtacgcggctggcacgggc
atacagagcttctatcagggcaaggaagagaacctgaaggtgctccagaagatgtacacg
gactatccgttcttcacgtcgctgattgatacgcttcagatggcactcgccaaggcggat
ctgatcattgctaaggaatactccttaatgacaaaggacgatacgtcacgcgagcgcatc
tttggaatgatccaggaagagttcaacctgacgaaggaccttgtcctcaaaatcaccggg
cagcaggacattctggataatcaaccggtactgcaggagtcgattcgactccgcaaccct
tacgtcgatccgcttagctacctgcaggtccagcttctcaacgagcttcgcagcttaaga
gagcaggggcaggatgatgccgagctgcttcgcgaagtgctgctcacaattaacggcatt
gcggcaggacttcggaatacgggctga

DBGET integrated database retrieval system