KEGG   Paenibacillus ihbetae: BBD41_18960Help
Entry
BBD41_18960       CDS       T05154                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pib  Paenibacillus ihbetae
Pathway
pib00020  Citrate cycle (TCA cycle)
pib00190  Oxidative phosphorylation
pib00650  Butanoate metabolism
pib01100  Metabolic pathways
pib01110  Biosynthesis of secondary metabolites
pib01120  Microbial metabolism in diverse environments
pib01130  Biosynthesis of antibiotics
pib01200  Carbon metabolism
Module
pib_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pib_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pib00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBD41_18960
   00650 Butanoate metabolism
    BBD41_18960
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BBD41_18960
Enzymes [BR:pib01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BBD41_18960
    1.3.5.4  fumarate reductase (quinol)
     BBD41_18960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored AlaDh_PNT_C NAD_binding_8 DAO Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ANY74480
UniProt: A0A1B2E3B9
LinkDB All DBs
Position
4289958..4291703
Genome map
AA seq 581 aa AA seqDB search
MAASNIIVVGGGLAGLMATIKAAEAGAHVHLFSLVPVKRSHSVCAQGGINGAVNTKGEGD
SPWEHFDDTVYGGDFLANQPPVKAMCEAAPGIIHLMDRMGVMFNRTPEGLLDFRRFGGTK
HHRTAFAGATTGQQLLYALDEQVRRWETAGLVTKYENWEFLNAVIDDEGVCRGIAAQDLR
SMEIRAFKAEAVILASGGPGIIFGKTTNSVINTGTAASAVYQQGVYYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFSVCVDMG
LGINGENMVYLDLSHKDPKELDVKLGGIIEIYEKFMGDDPRKIPMKIFPAVHYSMGGMWV
DYNQMTNIPGLFAAGECEYQYHGANRLGANSLVSAIYGGMVAGPKAIEYIKGLKKSSEDI
SSSVFDRYTKEQTAKYEGLLKMEGTENAYVIHKELGEWMTNNMTVVRYNDKLQETINKIK
ELKQRYRNINMTDTSRWNNQGVAFTRQLWNMLELAEAMTLGALLRNESRGAHYKPEFPDR
NDEEFLKTTKAKWTPEGPQISYEEVDVSLIPPRIRDYSKEK
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggcagcatctaatattatcgtagtgggcggaggcctggccggattgatggcaaccatc
aaagcggccgaagcgggagcccatgttcatctgttctcactggtacctgtgaaacgttct
cactccgtgtgcgcgcaaggcggcattaacggagcggttaatacgaaaggcgaaggcgac
tccccgtgggagcactttgacgatacggtttacggcggggacttcctggcgaaccagccg
ccggtcaaggctatgtgtgaagcggctccgggcattattcacctgatggaccgcatgggc
gttatgttcaaccgtacgccggaaggccttctcgatttccgccgcttcggcggaacgaag
catcaccgtacggcgtttgccggagcgacgaccggccagcagctgctgtacgcgctggat
gagcaggtgcgccgctgggaaactgcgggtctcgtgaccaagtacgagaactgggagttc
ctgaacgcggtcattgacgacgagggcgtatgccgcggcatagccgcccaggaccttcgc
tccatggagatccgggcgttcaaggcggaggccgtcattttggccagcggtggtcccggc
atcattttcggtaaaacgacgaactcggttatcaacaccggtacggcagcaagcgcggta
taccagcagggcgtatactacgccaatggcgaattcatccagattcacccgaccgccatt
ccgggcgacgacaagctgcgtctgatgtcggaatcggcccgcggtgaaggcggccggatc
tggacctataaagacggaaagccttggtatttccttgaagagaaataccctgcatacggc
aacctcgttccgcgggatatcgcaactcgcgagatcttctccgtatgtgtggacatgggt
cttggcattaacggcgagaacatggtatacctggatctctcccataaggatccgaaggag
ctggacgtgaagctcgggggcatcatcgagatctatgagaagtttatgggtgacgaccct
cgcaaaattccgatgaagatcttcccggcagtccattattccatgggcggcatgtgggtc
gattacaaccagatgacgaatattccgggtctgttcgcagccggggaatgtgaatatcaa
tatcacggagccaaccgcttgggagccaactcgctcgtatcggccatttacggcggtatg
gtcgcaggtccgaaggcgatcgagtatattaaaggcttgaagaaatcgtccgaggatatc
tcctccagcgtcttcgaccggtacacgaaagagcaaaccgcgaagtatgaagggcttctg
aagatggaaggcacggaaaatgcttacgtgattcataaagagcttggcgaatggatgacc
aacaacatgaccgttgtccgctacaacgacaagctccaggagaccatcaacaagatcaag
gaattgaagcagcgctaccgcaacatcaacatgaccgatacatcccgctggaacaaccaa
ggcgtggcgttcacgcgtcagctgtggaacatgctggagcttgcggaagctatgacgctt
ggagccctgctccggaacgaaagccgcggagcccattacaagccggagttccctgaccgc
aatgatgaggagttcctgaaaacaacgaaagcgaaatggacccctgaaggtccgcaaatt
tcgtacgaagaagtggatgtttccttaatcccgccgcgtattcgcgactattcgaaagaa
aagtaa

DBGET integrated database retrieval system