KEGG   Paenibacillus ihbetae: BBD41_18965Help
Entry
BBD41_18965       CDS       T05154                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pib  Paenibacillus ihbetae
Pathway
pib00020  Citrate cycle (TCA cycle)
pib00190  Oxidative phosphorylation
pib00650  Butanoate metabolism
pib01100  Metabolic pathways
pib01110  Biosynthesis of secondary metabolites
pib01120  Microbial metabolism in diverse environments
pib01130  Biosynthesis of antibiotics
pib01200  Carbon metabolism
Module
pib_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pib_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pib00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBD41_18965
   00650 Butanoate metabolism
    BBD41_18965
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BBD41_18965
Enzymes [BR:pib01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BBD41_18965
    1.3.5.4  fumarate reductase (quinol)
     BBD41_18965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_17 Fer4_2 Fer4 Fer4_13 Fer4_15 Fer4_16 Fer4_21 Fer4_4 Fer4_3 Fer4_6
Motif
Other DBs
NCBI-ProteinID: ANY74481
UniProt: A0A1B2E3G8
LinkDB All DBs
Position
4291719..4292483
Genome map
AA seq 254 aa AA seqDB search
MAQTATASKSVKFIITRQDNPESKSYTEEFEVPYRPGMNVISALMEIQRNPKNAQGQTTS
PVCWDSNCLEEVCGACSMVINGKPRQACAALIDKLEQPIRIQPMKTFPVVRDLVIDRSRM
FSALKRVKAWIPIDGTYDLGPGPRMAEKKRQWAYELSKCMTCGVCLEACPNVNEKTDFIG
PAAISQVRLFNAHPTGELNKEERLEALMQDGGIEGCGNSQNCVRSCPKGIPLTTSIAEMN
KETTKHLFKRWLSV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaacggcaaccgcctcaaagagtgtgaaatttattataactcgccaggacaat
ccggaatccaaatcgtatacagaggaatttgaggttccatatcgtcccggcatgaacgtc
atcagtgcgctgatggaaattcagcgcaatccgaagaacgcgcaaggccaaacgacttcc
ccggtatgctgggactccaactgtctggaggaagtgtgcggtgcctgttcgatggtcatc
aacggtaagccgcgccaggcctgtgctgcactgatcgacaagctggagcagccgatccgc
atccagccgatgaagaccttccctgtcgtccgcgacttggtcatcgaccggagcaggatg
ttctccgccctgaagcgggttaaagcctggattccgatcgacggcacgtatgatctcggt
cccggtccccgcatggcggagaagaagcgccagtgggcttacgagctgtccaagtgcatg
acgtgcggtgtatgtctcgaggcttgcccgaatgtcaacgagaaaaccgactttatcggt
cctgcggccatttcccaggttcgcttgttcaatgcccatccaacgggcgagttgaacaag
gaggagcgtcttgaggcgcttatgcaggacggcggcatcgaaggctgcggcaactcgcag
aactgcgtacgctcctgtccgaaaggcattccgctgacgacatcgatcgcggagatgaat
aaagaaacaacgaagcatctgttcaagcgctggctcagcgtctag

DBGET integrated database retrieval system