KEGG   Paenibacillus ihbetae: BBD41_19815Help
Entry
BBD41_19815       CDS       T05154                                 

Definition
(GenBank) phage tail tape measure protein
Organism
pib  Paenibacillus ihbetae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF445 T2SSM DUF572 ArAE_1_C
Motif
Other DBs
NCBI-ProteinID: ANY74631
UniProt: A0A1B2E3V6
LinkDB All DBs
Position
4464268..4465965
Genome map
AA seq 565 aa AA seqDB search
MDNIMRAIEAARRRLQRFRVIAYALYGLAAGFVLSLLLLIIGRFVPISWMNIAAAAIPAA
GLLAGLLWGWLRRIPAADAAAAMDQASGGAERSDMMVTALSFREEDSAAARWQREQAEAY
GKRFTEQLAERLPSPRRNRQLLICAVGLVAVVVLALIPNPMDKKVEAAKEQKNWIQEQAA
KTEKLAEQLEKETLDPVDRQKLKEKLDELRQALAKEKQPEQALEKIEKAMEELEKLAKQQ
EEKAKALSELAKQMQQQKALSEAGKKLEEGKSEEVKQEMKKVSEQVKKMPQEEKDRLSDA
LKKLAEEAAKQQGNEELEKALSKAAEALKEGKLPKELEEELQKLAEELAETALAKAASES
QSEAAAALASSLASQGLAMADQMKAAGLSVSDAWANGGSAEALAQAGLGESSGEQSENGG
SGSGAGSDQQGSGSGQGAGSGSGSGSGSGQGSGSGSGSGAGSGSGSGSGVGSGAGLGSGG
RELVTIPRNFKGGGNVQNDSGELNGSGGDIQKGGISPTIPGTSRPYEEVYRDYETKARNT
LDRNQLPDQMQGLVEEYFIQINPNP
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
gtggacaacatcatgcgcgcaatcgaggcggcacgccggcggctgcagcgcttccgggtc
atcgcttatgcgctgtacggactcgcggcaggctttgttctatcgctgctgctgctgatc
atcgggcgtttcgtgccgatatcgtggatgaacatcgcggcggctgccattccggcggcc
ggcctccttgccggccttctctggggatggcttcgccggattccggctgcggacgcggcg
gcggccatggaccaggcatccgggggcgccgagcgaagcgatatgatggtgaccgctttg
tccttccgggaggaagattcagcggccgcccgctggcagcgggagcaggcggaagcttac
ggcaagcgattcacggagcaattggccgagcgtcttccctctcctcgccgtaaccgtcag
ctgctgatctgcgccgtgggtctggttgccgtcgtggtcctggcgctgattccgaacccg
atggataagaaggtggaggcggccaaggaacagaagaactggattcaggagcaggcggcc
aaaacggaaaagctcgccgagcagctggagaaggagacgctggacccggtcgatcggcag
aagctgaaagagaagctggacgaactgaggcaagcgctggctaaagaaaagcagcccgag
caggcgctggagaagattgaaaaggcgatggaggagctggagaagctggcgaagcagcag
gaggagaaggccaaggcgttatccgagctcgccaagcaaatgcagcagcagaaggcgctt
tccgaagcgggcaagaagcttgaagaaggaaagtccgaagaggtcaagcaggagatgaag
aaggtatccgagcaagtcaagaaaatgccgcaggaagagaaagaccgtttatcggatgcc
ctgaaaaagcttgcggaggaagcggccaagcagcagggaaatgaagaactggaaaaggcg
ctgtccaaagcggccgaggcgctaaaagaaggcaagctgccgaaagagctcgaagaggag
ctgcagaagctggctgaagagctggccgaaacggcgctggcaaaggctgcttccgagagc
cagtcggaagcggcagcggctttggcctcatccctcgcttcacagggattggccatggcg
gatcagatgaaggcagcaggcttgtcggtatccgacgcctgggcaaacggcggaagcgcg
gaggcgctggcgcaggctggccttggggaaagctcgggagagcagagtgagaacggcggc
tccggttccggcgcgggctcggaccagcagggctcggggagcggccaaggcgcaggcagt
ggctccggttccggttctggcagcggtcaggggtccggcagcggctccggttcaggagca
ggctctggctccggttcgggcagcggggtaggaagcggtgccgggctcggcagcggaggg
cgcgagcttgtcacgattcctcgaaacttcaagggcggcggcaacgtccagaacgattcg
ggagagcttaacggctccggcggcgatatccagaaaggcggcatatcgccgaccatcccc
ggcacgtcgcgtccgtacgaggaagtctaccgggattatgagaccaaagccagaaacacg
ctagaccggaatcagctccctgatcaaatgcaggggttggtggaggaatatttcatccag
atcaatccgaatccgtga

DBGET integrated database retrieval system