KEGG   Paenibacillus ihbetae: BBD41_20290Help
Entry
BBD41_20290       CDS       T05154                                 

Definition
(GenBank) hypothetical protein
Organism
pib  Paenibacillus ihbetae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TMF_TATA_bd bZIP_1 GIT_CC
Motif
Other DBs
NCBI-ProteinID: ANY74713
UniProt: A0A1B2E426
LinkDB All DBs
Position
4565542..4567407
Genome map
AA seq 621 aa AA seqDB search
MTTPDRKSVTVDIYGTSYKLVGSSSDYTKQVASYVDERMRTISKAHNRLDTPRIAVLAAV
HMAEEALQMQHYQNEAKQLNTERNELRSELARVQGLQIEQQERHRQQSELMERKLAEQTA
LAEEYRSAKETLAAESERTKELLQKESARVSELQRDKEQLEEQLKKQREELERRHQQALE
EMKRRHESQQQQLNGSHKQALEKLEQQYQASAKEEAEKHAQHAKKQEESFKQQALQKDRQ
HAAAVQELEKQLSDQRSRGSQLQSRLAAAEKELGALKGESQKLKEDLLQARQQGKNAEQE
LQKLRSQLQQLTEERDSLKAESAKSEEERRRLQKLVVDANQASRKHQEELQRLSQELQSW
RTLADQRKVETGELEMRIVELMEGNESLEEGLRGLHDEIGVLKDEAERANADRKAARQEL
LELQHRYDELEKLGKEAETREEETHKLYAMLEEEYDTLSGQLEELRRKADASEEHSQELA
KRLREAEERAAHWQEQCEQWMAERDQLAEETERLHAERDEWKKSRDALEEELTSWQREIA
SAKEACERMESEKKDAEAQYAELGEQYEVIMHQYRLLQAEQELKAEQTAQLEEEHKKLKE
EYAKLQVEYNEWIELIEQDQR
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
gtgacaacaccggatcgtaaaagcgtcaccgtagacatctacgggacttcctataaactt
gtcggcagcagcagcgactatacgaaacaggtcgcgagctatgtggacgaacggatgcgc
acgatatccaaggcgcacaaccggctggataccccgcgcattgccgtccttgctgccgta
catatggctgaagaagcgctgcaaatgcagcattatcagaatgaggccaagcagcttaat
acggagcgtaacgagctgcgctccgagctggcgcgtgttcaggggctgcagattgagcag
caggaaaggcatcgtcagcagagcgagctgatggagcggaagctggccgagcagaccgcg
ctggccgaggaataccggagcgcgaaagagaccctggcggcggaatccgagcggaccaag
gagctgctgcagaaggagtctgcgcgtgtgtctgagctgcagcgggataaggagcagctg
gaagagcagctgaagaagcagcgagaagagctggagcggcggcaccagcaggcgctggag
gaaatgaagcggcgtcatgaaagccagcagcagcaattgaacggaagccataagcaggcg
ctggagaagctcgagcagcagtatcaggcatccgccaaagaggaagccgagaagcatgcc
cagcatgccaagaagcaggaggaatccttcaagcagcaggcgcttcagaaagaccggcag
catgcggccgccgtacaggagctggagaagcagctgtcggatcagcgaagccggggaagt
cagctgcagtcgcgcctggcagccgccgagaaggagctgggcgcactcaagggcgagtcc
cagaagctgaaggaggatttgcttcaggccagacagcagggcaagaacgccgagcaggag
ctgcagaagcttcggagccaattgcagcagctgaccgaggagcgggacagcctgaaagcc
gaatccgccaagtcggaagaggaacggcgccgccttcagaagctcgtcgtggatgcgaat
caggcttcgaggaagcatcaggaggagctgcagcgcttgagccaggagcttcagtcgtgg
cgcacgctggccgatcagcgtaaagtggagaccggcgagcttgagatgcggattgtcgag
ctgatggaaggcaacgaaagcctggaggaaggcttgagaggcctccatgatgaaatcggc
gtactgaaggatgaagccgaacgcgcgaatgccgaccggaaagcggcccggcaggaattg
ctcgagctgcagcaccggtatgacgagcttgagaagctgggcaaggaagcggagacccgc
gaggaagaaacgcataagctctacgcgatgctggaggaagaatacgataccctttccggc
cagctggaagagcttcgccgtaaagctgatgcaagcgaggagcacagtcaagagctggcg
aagcggttaagagaggcagaggaacgagcggctcactggcaggagcaatgcgagcaatgg
atggcggagcgggatcagctcgcggaagagacggagcggcttcatgccgaacgcgacgaa
tggaagaagtcccgggacgcgctggaagaggagctgacttcttggcagcgtgaaatcgcg
tccgcgaaggaagcctgcgaacggatggagagcgagaagaaggatgccgaggcgcagtac
gccgagctgggcgagcaatatgaggtcatcatgcatcaataccggctgctgcaggccgaa
caggagctgaaggcggagcaaaccgcccagctcgaagaagaacataagaagctgaaggaa
gagtacgccaagcttcaagtcgaatacaatgaatggattgaactgatcgagcaggaccag
cgataa

DBGET integrated database retrieval system