KEGG   Paenibacillus ihbetae: BBD41_24065Help
Entry
BBD41_24065       CDS       T05154                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pib  Paenibacillus ihbetae
Pathway
pib00564  Glycerophospholipid metabolism
pib01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pib00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BBD41_24065
Enzymes [BR:pib01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BBD41_24065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 FAD_binding_3 FAD_oxidored Pyr_redox_2 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: ANY76701
UniProt: A0A1B2E9Q1
LinkDB All DBs
Position
5408700..5410382
Genome map
AA seq 560 aa AA seqDB search
MDTTHYELIVIGGGITGAGIALDAVTRGMSVLLLEMQDFASGTSSRSTKLVHGGLRYLKQ
FEVGMVAEVGKERAVVYENGPHVTTPEWMLLPIHQGGTFGKFSTSIGLMVYDFLAGVKRG
ERRSMLSSEETLKREPLLRRDGLKGGGYYVEYRTDDARLTLEVMKEAAARGANVFNYVKV
ESLNYDANGRITGVTARDMLDGEVRQAAGSQIVNASGPWVDRVREMDKSKKGKMLQLTKG
VHLVIDQSKFPLRQAVYFDTPDGRMVFAIPRDGKTYVGTTDTVYKADPARPFITVQDRDY
ILKAISYMFPDIRLSPSDVESGWAGVRPLILEEGKSPSEISRKDEIWESPSGLITIAGGK
LTGYRKMAETVVDLVAKRLQENGGKSYGAGVTRELPISGGKVGGSAHFPDFVRTQADQGA
ALGIDRKLAEQWANMYGSNVAELFRLAGEESAGSGAQAEAEALPLSVLVPLRYAIEHEMA
VKPVDFFIRRTGSLLFNIEWTRRWKGSVIDYMASMLGWDDDEKEMYALELQEELARAEHA
APSEESGLEAAAASASKLSS
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggataccacgcattacgaattaatcgtcattggcggagggataacgggagcgggcatc
gcgcttgatgcggtaacccgcggcatgtcggtgctgctgctggaaatgcaggattttgct
tccggcacgagcagccgctcgaccaagctggtgcacggcgggcttcgttatctgaagcag
ttcgaggtcgggatggtggctgaggtcggcaaggaaagagcggtcgtttatgagaacggt
ccccatgtcacgacgccggaatggatgctgcttccgattcaccagggcggcacgttcggc
aaattcagcacgtcgatcgggctcatggtgtatgatttcctggcgggcgtcaagcgggga
gagcggcgctcgatgctctcctcggaggagacgctcaagagggagccccttctcagacgg
gacggcttgaagggcggcggttattacgtggaataccggacggatgacgccagactgacg
ctggaggtcatgaaggaagcggcggccagaggcgcgaacgtgttcaattatgtcaaggtc
gaatcgctgaattacgatgcgaacggacgcattaccggcgtcacggccagagatatgctc
gacggcgaggttcggcaggcggccggcagccagattgtgaatgcatcggggccgtgggtc
gaccgcgtaagggagatggataaatccaagaaaggaaaaatgctgcagctgaccaaaggc
gtgcatctggtcatcgaccagtcgaagttcccgcttcgtcaagccgtatatttcgatacg
ccggacggacggatggtgtttgcgatcccaagggacggaaagacatacgtcgggactacg
gatacggtatataaagctgatcccgcaaggccgttcattacggtccaggaccgggattac
atcctgaaggcgatctcttatatgttcccggacatcaggctgtccccgtccgacgtagag
tccggctgggccggggttcggccgctcattctggaggaaggcaaaagcccttcggaaata
tcccgtaaagatgagatctgggaatctccgtcggggcttataacgattgcgggcggcaag
ctgaccggctatcgcaagatggcggaaaccgtcgtcgaccttgttgcgaagcgacttcag
gagaacggcggcaagtcttacggcgccggcgtcacccgcgagcttccgatctcgggcgga
aaggttggcggctctgctcatttcccggattttgtgcgcactcaagccgatcagggcgcg
gcccttgggatcgaccgcaagctcgcggagcagtgggcaaacatgtacggctcaaacgta
gccgaactattccgcttggcaggcgaggaatccgcgggctcgggtgcgcaggcggaggcg
gaggcgctgccgctgtcggtgctcgttccgctgcggtatgcgatcgagcacgaaatggct
gtgaagccggtggacttctttatccgccgaaccggctccttgctgttcaatatcgaatgg
acccggagatggaaggggtctgtcatcgattacatggcctcgatgctgggctgggacgat
gacgagaaggagatgtatgctcttgagctgcaagaggagctggccagggcggagcatgcg
gcgccttccgaggaaagcggattggaggccgcggcggcctctgcaagcaagctgtcatcc
tga

DBGET integrated database retrieval system