KEGG   Paenibacillus ihbetae: BBD41_27775Help
Entry
BBD41_27775       CDS       T05154                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pib  Paenibacillus ihbetae
Pathway
pib00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pib00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BBD41_27775
Enzymes [BR:pib01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BBD41_27775
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BBD41_27775
    1.1.1.-  
     BBD41_27775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N ADH_N_assoc Shikimate_DH 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ANY76766
UniProt: A0A1B2E9W9
LinkDB All DBs
Position
6257313..6258362
Genome map
AA seq 349 aa AA seqDB search
MQALRWHGVKDLRLENIEEPQATKGKVKIKVEWCGICGSDLHEYVAGPIFIPESTPHALT
GEQAPIVMGHEFSGQVVEVGEGVTRFKAGERVVVEPVFSCGTCDACRQGKYNLCEKMGFL
GLAGGGGGFSEYVAADEHMVHKIPDTVSYEQGALVEPSAVALYAVRQSQLKAGDRAVVFG
AGPIGLLVIEALKAAGASDIYAVELSEERKQKAAELGAIVLDPKACDVVEELKQRTGRGV
DVAYEVTGVPPVLTQAIHSTKIGGQIMIVSIFETSAPIIPNDIVMNERSITGIIGYRDVF
PAVISLMEKGFFPADKLVTQKIKLHEVLERGFEALLKEKNQVKILVSAH
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcattacgctggcatggtgtgaaggatctgcggctcgagaacatcgaggagcct
caagcaacgaaaggtaaagtgaaaatcaaggtggaatggtgcggtatttgcggaagtgac
ctccacgaatacgtagccggaccgatttttatacctgaatcaaccccgcatgcgcttacc
ggagaacaggcgccgatcgttatgggacatgaattttcgggccaagtggttgaagtcggg
gagggagtaacccgctttaaagccggcgaacgcgttgtcgtcgagcctgttttttcatgc
gggacttgcgatgcttgccgtcaaggcaaatacaacttgtgtgaaaaaatgggcttcctg
ggacttgccggcggaggcggcggattctccgaatacgtcgcagcggatgagcatatggtg
cacaaaatacccgacaccgtttcgtatgagcagggggcattggttgagccgtcggccgtt
gccttgtatgcagttcgccaaagccagctgaaagccggagaccgtgccgtcgtgtttggc
gccgggccgatcggactgcttgtcatcgaggcgctcaaggctgcaggggcttcggacatc
tacgccgtagagctgtccgaagagcgcaaacagaaggcggcggagttaggggcaatcgtc
cttgatcccaaggcctgcgatgtcgtcgaagagctgaagcagcgtaccggcaggggtgtc
gatgtcgcttatgaagtgaccggcgttccgccggtgctgacccaagcgatccattctacg
aagatcggcgggcagattatgatcgtcagcatattcgaaacctccgcgccgatcattccg
aatgatatcgttatgaatgaacggagcatcaccggcatcatcggctatcgagacgtattc
ccggccgtaatcagcctgatggagaagggcttcttcccggccgacaagctcgtgacgcag
aagatcaagcttcatgaagtattggagcgtggatttgaagcgctgcttaaggaaaagaac
caggtgaagattctggtgagcgcccattaa

DBGET integrated database retrieval system