KEGG   Scheffersomyces stipitis: PICST_28187Help
Entry
PICST_28187       CDS       T01023                                 

Gene name
WSC3
Definition
(RefSeq) cell wall integrity and stress response component 3
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00500  Starch and sucrose metabolism
pic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PICST_28187 (WSC3)
Enzymes [BR:pic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PICST_28187 (WSC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAP18_C
Motif
Other DBs
NCBI-GeneID: 4850966
NCBI-ProteinID: XP_001387751
JGI: 28187
UniProt: A3GFB7
LinkDB All DBs
Position
1
AA seq 265 aa AA seqDB search
MHAIRNVEDSGMSDSDSTISNSSTISFSSLKTPDRRTSRMRGSTASTSTNASFTSAASTF
SSAASAFTATTASTSLTRDTRDSAKVPVSVVPSPSSTYVYTRDGRLAPCVAYVVAQLKMM
SEQASEDKEAGSGIEVASRRGTTLSNVQVIYFNNTGPYELITLVDNDNLGRIIDYEQIDT
IQEIRNKIGEKAKAMPESTRLVVVIENLYSILESPQAQLSYNEKNQLLVSVVRKATSGTT
PYALFLVDKEYSSYVSMLVDEEVEV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcaattaggaatgtcgaagattcaggaatgtctgattcagactcgacaatttca
aactcgagcacaatctcattttccagcttgaagacgccagacagacgcaccagtcgtatg
agagggtcgactgccagcacatccaccaacgcatcctttacactggccgcttccacgttt
tcgtcggccgcttcagcgttcacggctaccacagcatctacgtctttaaccagagacacg
agagactccgctaaagttccagtgtcggtggttccttcgccatcctcgacatatgtctac
accagagacggccgtttggcaccctgtgtcgcctacgttgttgcccaattgaagatgatg
tccgagcaggccagtgaagacaaggaagccggtagtggtatcgaagttgccagtagaaga
ggcactactctttcgaatgtccaggtgatctacttcaacaatactgggccctacgagctt
ataacgcttgtggataacgataacctagggaggattatagactacgagcagatcgatacc
atacaagagatcaggaacaagatcggcgagaaggccaaggcgatgcccgagagcacaaga
ttggtggtggtgatcgagaacttgtatctgattttagaactgccacaggcgcagctctcg
tacaacgagaagaaccagttgttggtgagtgtagtgaggaaggctacgagtggaacgacg
ccgtatgcgttgtttctagttgacaaggagtacagcagctacgtgagcatgttggtggat
gaagaggtagaggtgtag

DBGET integrated database retrieval system