KEGG   Scheffersomyces stipitis: PICST_34373Help
Entry
PICST_34373       CDS       T01023                                 

Gene name
HOS3
Definition
(RefSeq) histone deacetylase
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
pic  Scheffersomyces stipitis
Brite
KEGG Orthology (KO) [BR:pic00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pic03036]
    PICST_34373 (HOS3)
Enzymes [BR:pic01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PICST_34373 (HOS3)
Chromosome and associated proteins [BR:pic03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     PICST_34373 (HOS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl SF3A3 MA3
Motif
Other DBs
NCBI-GeneID: 4851393
NCBI-ProteinID: XP_001387967
JGI: 34373
UniProt: A3GGJ4
LinkDB All DBs
Position
1
AA seq 708 aa AA seqDB search
MSLQETLSKHNDSEESLISQFETTLTIRPTANDDDEVKDITIDQSTVLHNNTFNYTRDQS
IVDIDELEEEELISEQIPKFKTRRRYSLLPAHATKITTKNPGGLDGYYSHIGPKFEHILK
PSPLIDQSLSNDSDKTLVILSPYSTEHAFGRKWVTKSYLSTIFERPQRLLASCIGVASAL
TMFPFHYKLINSTRRGSIFASHVRKIHGKNWPRKLFELCIESHDKLLNDTLEVPEDWNSG
DIYVNPRTLNAIEGVIGTIETAVDSLYGGTNAEDVEDNHNLAFVVIRPPGHHSHACLPSG
FCLLNNVQIGIEYAFERYGVTHCVILDIDLHHGDGSQDICWERAGFQGDYGQDEDDEIDP
KSNPRDDYGKRFATFPKVGYFSLHDIKSYPTELGYATKENIKNASTCIMDHDLNIWNVHL
QEWSKEEEFYKHYQTKYVALLNRANQFLNTAKKQYEQQYQDYLNNLAKYNKFLLKPHLYQ
GQSLEKPVAPPPFKPLITISAGFDASEYENPQMQRHGINVPTSFYATFTHDVVKLAKIHT
DGRVISFLEGGYSDGALTTGIFSHLIGLNNDEEFLWNPTWGTDQVMKELTKGCKKNWAPY
KKPQSDITIWANEVIKLGRAMMPNAILPSNYVYQYQEEELKAPVNKMVKELIAHNVNLGE
ISNSPLKKDPEDERKVMRHTRSYYKKMANAQKQQSIETDSAKHNLPKY
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgtccttacaagaaaccctttccaaacacaacgattccgaagagtcgttgatctcacag
tttgaaacaacccttacaatcagacccacagccaacgatgacgatgaagtcaaagatatc
accattgaccaatctacagttcttcacaataacacattcaactatacacgcgaccagagc
atagttgatattgatgagttggaagaggaggaattgatcctggaacaaatccccaagttc
aagactagaagaaggtattcgttgttaccggcacatgcgacaaaaatcaccaccaaaaac
ccgggtggcctagacggatactacagccatattggccccaagtttgagcacatattgaag
ccgtcacctcttatagatcaatcattatctaacgattctgataaaactttggttattttg
tcgccttactcaactgaacatgcctttggtagaaaatgggttacgaagtcctatttatcg
actatttttgaaagacctcagagactcttggcttcttgcataggggtagcttcagcattg
accatgtttccttttcactacaagctcatcaattccactagaagagggtcgatcttcgct
agtcacgttcgtaaaattcatggcaaaaattggccccgtaagctttttgaactctgtatc
gagtcgcatgacaaattattgaacgatactttggaggtgccggaagattggaactcaggg
gatatttatgtgaatccgaggacccttaacgccatcgaaggcgttattggaactattgaa
acagccgtagactcgctttatggtggaactaatgctgaggatgtggaagacaaccacaac
ctagcatttgtagtcataagaccaccaggacaccactcacatgcatgtcttcccagtggg
ttctgtttgttgaacaatgttcaaattggtatagagtatgcctttgaacgttacggagtc
acacattgtgtgattctcgacatcgacttacaccacggagatggttctcaggatatttgc
tgggaaagagctggattccaaggcgattacggacaggacgaagatgacgagatcgatccc
aagtcaaatcctagagatgactacggaaaacggttcgctacgtttccaaaagtaggctat
ttttcgttgcatgacatcaagtcatatcccactgagttgggatatgctaccaaagaaaac
atcaagaacgcttctacttgtatcatggaccacgacttgaatatttggaatgtccattta
caggagtggagcaaggaagaggaattctacaagcattatcaaaccaagtatgtggcactt
cttaatcgagcaaaccagttcttgaacacagctaagaaacaatacgagcaacagtatcaa
gattacttgaacaacctagccaaatacaacaagttcttgcttaagccccatttgtaccag
ggacaatcgcttgagaagcccgtagcaccaccgcccttcaagccgttgattacaatttct
gctggttttgatgctctggagtatgagaatccccagatgcagcgacatggaatcaatgtt
cccacgtcgttttatgctacttttactcacgatgttgttaaattagcgaagatccatacg
gatggtagagtgatttcctttttagaaggaggttactctgatggtgccttgactaccggt
attttctcgcatttaattggattgaacaacgacgaagagttcttgtggaatccaacatgg
ggaacagaccaggtgatgaaggagttgacaaaagggtgtaaaaagaactgggctccttac
aagaaaccacagagcgatattactatctgggccaacgaagtaatcaagcttggccgggct
atgatgcccaacgccattcttccaagcaactatgtgtaccaataccaagaggaagagttg
aaggcaccggtgaacaaaatggtgaaggagttgattgctcacaacgtgaacttgggagaa
atttccaacagtccgttgaagaaggatcccgaagacgagcgcaaggtcatgagacatacg
agatcatactacaagaagatggccaatgcccaaaagcagcagtcgatagaaactgactcg
gccaagcataaccttcccaaatactga

DBGET integrated database retrieval system