KEGG   Scheffersomyces stipitis: PICST_42120Help
Entry
PICST_42120       CDS       T01023                                 

Gene name
MAL6
Definition
(RefSeq) alpha-glucosidase maltase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00052  Galactose metabolism
pic00500  Starch and sucrose metabolism
pic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PICST_42120 (MAL6)
   00500 Starch and sucrose metabolism
    PICST_42120 (MAL6)
Enzymes [BR:pic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     PICST_42120 (MAL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 4836930
NCBI-ProteinID: XP_001382912
JGI: 42120
UniProt: A3LNM1
LinkDB All DBs
Position
2
AA seq 572 aa AA seqDB search
MTIARNWWKNATVYQIWPASYKDSNGDGFGDIPGIISTLDYLKDLGVDVIWCSPMYDSPQ
DDMGYDISDYEKVYPKYGTNEDMQALIDETHKRGMKLVLDLVINHTSSEHAWFKESRSSK
TNPKRDWYIWKPPKFDADGKRHPPNNWSSYFSGSAWEYDELTEEYYLRLFARTQPDLNWE
NDETRKAVYDSAMKFWLDKGIDGFRIDTAGLYSKDQRFPDCPIVYPDEEFQPSQKYSSNG
PRIHEFHKEMYANVTSNYDAMTVGEVGHCSREDALKYVSAKEQEMNMIFLFNAINVGYDK
ADRYRYKGWTLTDFKKAIQKDSSFIEGTDAWSTVFIENHDIARSVTRFGSPKHTSKSAKL
ISLLESTLTGTLFIYQGQEIAMENLPRSWSIEEYKDINTVNYYKQFKEKYGNDPDFKEKE
EKLMDIINLVSRDHARSPVQWDSSPHGGFTTGTPWTRVNDNYKAINVASQIDDPNSVLNF
WKKSIQIRKQYQDLLIFGSFKILDFDNETVFTYVKEDENAASPKAYVVLNFSNDSVKFEK
LIDGEFELVHSTTDDIDESTLSPYEGRLYIVD
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgctcgcaactggtggaaaaatgccactgtataccaaatctggccagcttcg
tacaaggactccaatggagacggttttggtgatatcccaggtatcatatcaacattggac
tacctcaaggatttaggagtggatgtgatttggtgtagtcccatgtacgactcgccgcag
gatgacatggggtatgacattagcgactacgaaaaggtttacccgaagtatggaactaac
gaagatatgcaggcacttatagacgaaacgcataagcggggcatgaaattggtgttggat
ttggttatcaaccatacttctagcgagcatgcctggttcaaggaatccagatcctcgaag
accaacccaaaaagagattggtatatttggaagcctcctaaatttgatgcagatggtaag
agacatcctcctaataactggagttcgtatttttctggctcagcttgggaatacgacgaa
cttactgaagagtactacttaagactctttgccagaactcaacctgatttgaactgggaa
aacgacgaaaccagaaaggcagtctatgactctgctatgaagttttggctcgacaagggt
attgatggctttagaattgatacagctggattgtattcaaaggatcaacgcttcccggat
tgtcccattgtatacccagatgaagaatttcagccaagtcaaaagtatagtctgaatggg
ccccggattcatgaattccacaaggaaatgtacgccaatgtaactagcaactatgatgcc
atgacagttggagaagttggccattgttcacgagaagatgccttgaagtatgtcagtgcc
aaggaacaagaaatgaatatgatattcctcttcaatgctattaatgtcggttacgataaa
gctgatcgttacaggtacaagggctggaccttgactgacttcaagaaggccattcaaaag
gactcttctttcatcgaaggcactgatgcgtggtcgactgtcttcattgaaaaccatgac
attgctagatcggttactagatttggcagtcccaagcacacatcaaagtctgctaagttg
atttccttgttggagtccactttaacaggtaccctcttcatataccagggccaggaaatt
gccatggaaaatttaccaagatcttggtctatcgaagaatacaaggatatcaacactgtc
aactactacaagcagttcaaggagaagtatggtaatgacccagacttcaaggagaaggaa
gagaagttgatggacatcatcaaccttgtttccagagaccatgcaagatctccggttcaa
tgggattcttctccccatggcggtttcactacaggtactccgtggacaagagtaaatgat
aattacaaagccattaatgttgctagccagattgatgaccctaactcggtattgaacttc
tggaagaagtctattcaaataagaaagcaatatcaagacttgcttattttcggctcattc
aaaatcttagattttgacaacgagaccgtcttcacatatgttaaggaagatgaaaatgct
gcttctcctaaggcatatgtagtattgaacttctctaacgattccgtgaagtttgagaag
ttgatcgatggcgaatttgaacttgttcacagcaccactgacgacattgacgaactgaca
ttgtctccatatgaaggtcgtctatatattgttgattag

DBGET integrated database retrieval system