KEGG   Scheffersomyces stipitis: PICST_55334Help
Entry
PICST_55334       CDS       T01023                                 

Gene name
GAD2
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00250  Alanine, aspartate and glutamate metabolism
pic00410  beta-Alanine metabolism
pic00430  Taurine and hypotaurine metabolism
pic00650  Butanoate metabolism
pic01100  Metabolic pathways
pic01110  Biosynthesis of secondary metabolites
Module
pic_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PICST_55334 (GAD2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PICST_55334 (GAD2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PICST_55334 (GAD2)
   00430 Taurine and hypotaurine metabolism
    PICST_55334 (GAD2)
Enzymes [BR:pic01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PICST_55334 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 4836947
NCBI-ProteinID: XP_001382445
JGI: 55334
UniProt: A3LP27
LinkDB All DBs
Position
2
AA seq 507 aa AA seqDB search
MAITSDLETSRVEELDHLLTVLKPKLLSYIEKADRDSKNYEVNSLGHYYEPQFLKKQFFH
PPQATSIVGNDPQDDDKLFEVIDKVLEYSVNTWNPGFLDKLYASNNPIGVVSDIILSMLN
TNSHVYTVSPVLSIIENHIGRKYASLFFTNHRKTCGGLTFSGGSWSNITSLQMARSLRFP
DTKENGNGSYKFAVYSSKHCHYSVEKAAILLGLGSSNVFKVNILADGSMDANDLEKKIDQ
SIKDGYTPLYINATAGTTVFGSYDPFEKIADIAQKYKIHFHVDGSWGGNVIFSATHKKKL
AGVERADSITVNPHKMLGVPNTCSFLLVPHVSHFQESMSLKAPYLFHGREEEEDENYDLA
DGTMGCGRRADSFKFYMAWLYFGFEGFASRVDHAFAIARDFVEKISRDKRFELVIGDTEN
LPQCLQVCFYYRPSSYTHEDNTDITRYISRELHKQGKYLVDFSPNPTSSDNKGEFFRVVF
NSPILSDEVVDDLITSIVESGETYKHI
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcaattacttctgaccttgaaacttcccgtgtggaagaattggaccatcttctcacg
gtcttgaaacctaagcttttatcatacatagagaaggctgaccgagactcaaagaactac
gaagtcaactcattgggccactactacgaacctcaattcctcaagaaacaattcttccac
cccccacaggctacatctatagttggcaacgatcctcaagatgacgacaagttatttgaa
gtcatagacaaggtgctagaatattcagtcaatacctggaatccggggttcttggataaa
ctctatgcctccaacaatcccattggtgttgtttctgatatcattctttcaatgctcaac
accaattcgcatgtatatacggtttctccggtgttgtccattattgaaaaccatattgga
agaaagtatgcatctctcttttttaccaatcatcgcaagacctgcggaggcttgaccttt
tcaggaggctcatggtccaacatcaccagtttgcaaatggcacgtagtttacgtttccca
gacaccaaggaaaacggcaatggcagctacaaatttgccgtttattcgtcaaagcattgt
cactactcagtggaaaaggctgctatcttgttaggcttgggctcatccaacgtcttcaag
gtaaacattcttgctgatggctctatggatgctaatgatttggaaaagaaaattgaccag
tcaatcaaagacggatacactccactctacatcaatgccacagctggtacgactgtgttt
ggctcctacgatccgtttgaaaaaatcgccgatattgctcagaaatacaaaatccacttc
catgtagacggatcttggggtggtaacgtgatcttctctgccacacacaagaagaagttg
gcaggtgttgaaagagctgactcgatcaccgttaatccccacaagatgttgggggttccc
aacacatgttcgtttttgcttgtacctcatgtgagccacttccaagaatcgatgtcactt
aaggcaccctaccttttccatgggcgcgaagaagaagaggacgaaaactacgatctagct
gacggtactatgggctgcggcagaagagctgattcgttcaagttctacatggcatggctc
tattttgggtttgagggatttgcatccagagtagaccatgcttttgcaattgctcgtgat
tttgttgaaaaaatctccagagataagagattcgaattggttatcggcgacacagagaac
ttgccccagtgtctacaagtttgtttctactaccgtcctagtctgtacacccacgaggac
aataccgatattaccagatacatttcgcgagaattacacaaacaaggcaaatatttggtt
gatttctcgcccaatcccaccagcagcgataacaagggtgaatttttccgggttgtgttc
aattctcctattttgagcgacgaggttgtagacgaccttatcacgagcatcgttgaatct
ggtgaaacatacaaacacatttag

DBGET integrated database retrieval system