KEGG   Scheffersomyces stipitis: PICST_56703Help
Entry
PICST_56703       CDS       T01023                                 

Gene name
CGA1
Definition
(RefSeq) Glucoamylase 1 precursor (Glucan 1,4-alpha-glucosidase) (1,4-alpha-D-glucan glucohydrolase)
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00052  Galactose metabolism
pic00500  Starch and sucrose metabolism
pic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PICST_56703 (CGA1)
   00500 Starch and sucrose metabolism
    PICST_56703 (CGA1)
Enzymes [BR:pic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     PICST_56703 (CGA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N DUF5110
Motif
Other DBs
NCBI-GeneID: 4837769
NCBI-ProteinID: XP_001383835
JGI: 56703
UniProt: A3LRX2
LinkDB All DBs
Position
3
AA seq 951 aa AA seqDB search
MIFRDLIKSSVVALGVTNSVLEVASSTSSSGDSRATVPNDLTLGVKQVPNILNDTAVDAN
QEAKGYTLVNVTSTPRGLTGILELKEATNIYGYDFDHLNLTVTYQSDKRLNVHIEPTNLT
DVYILPEDLVVKPTIEGDVNSFNFEDSDLVFQYHSDDFSFEVVRASTGEVLFSTDGNPLV
FSNQFIQFNTTLPKGYAISGLGESIHGSLSLPGTVKTLFANDVGDPIDGNIYGVHPVYYD
QRYNSNTTHGVYWRTSAIQEVIFEEQSLTWRALSGVIDLYFFSGPDPKDVIQQYVSEIGL
PAFQPYWALGYHQCRWGYREIEDLEDVVTNFKNFNIPLETIWSDIDYMDSYKDFTNDPHR
YPTDKYQDFLDKLHKNNQHYVPIFDAAIYVPNPNNETDNDYTPFHAGNESDIFLKNPDGS
LYIGAVWPGYTAFPDFLANNTQDWWNEMFKEWHDRIPFDGIWSDMNEVSSFCVGSCGTGR
YFENPADPPFLVGGEVTQYPSGFNVSNSTEWKSISSSIAATATTSKPSPSSSSASIDSMN
TLLPGKGNINYPPYAINHAQGDHDLATHAVSPNATHADGTVEYDIHNLYGFLQEKAIHAA
LLEIFPNKRPFIIARSTFSGAGHYMGHWGGDNNADYDMMYFSIPQAFSMGLSGIPFFGVD
VCGFNGNSDAELCSRWMQLGSFFPFYRNHNVLGAISQEPYVWSSVADATRTSMAIRYLLL
PYYYTLLHESHVTGLPILRSLSWQFPYEKKYNGIDNQLFVGDALIVTPVLEPGVNKTKGV
FPGAGVSEVYYDWYTHEKQDFRNGKNETLAAPLGHIPLHVRGGHILPLQEPGYTVAESRE
NPFALLVALDNEGNASGKLYLDDGESLEIEESLYVDFVAHSKSLTASSFGEYNVSQPLAN
ITILGVEKKPKQVEFEDSKVKFSYENSTIFVTGLEKYTKEGAFAKQFTLTW
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgatattcagagacttaataaaatcttcggttgtcgctcttggagtgacaaactctgtg
cttgaggtcgcttcgagcacctcctcaagtggagactctcgagcaacagttcccaatgac
ttgactttaggtgttaagcaggttcctaacatcctcaatgatactgctgttgatgctaac
caggaagcaaagggttacactttggtcaatgttacctccacaccaagaggattgaccggt
attctcgagttaaaggaggctactaatatctatggttatgactttgatcatttgaacttg
acggtgacttaccagtctgacaagcgtttgaatgttcatattgaaccaacaaacttaacc
gatgtctacattttgcctgaagacttggttgtgaagccaactatcgaaggagatgtcaat
tcattcaatttcgaagactctgacttagtcttccagtaccactcggatgacttctcgttt
gaagtggttagagcttctaccggagaggttttgttttccactgatggtaatccattggta
ttttccaaccaattcattcaattcaacaccactttgccaaaggggtatgcaatttctgga
ttaggcgagtccatccatggttctttgagtttgccaggaactgtaaagactttgttcgct
aacgatgttggtgaccctatcgacggtaacatttacggtgttcatcctgtttactatgac
caaagatacaattcaaataccacccatggtgtctactggagaacatctgctatccaagaa
gtcatttttgaagaacaatctttgacctggagagcactttctggagttattgacttatac
ttcttcagcggtcctgaccctaaggatgttattcaacaatatgtttcagaaataggattg
ccagctttccaaccatactgggctcttggatatcaccagtgtagatggggttatcgtgaa
atcgaggacttggaagatgtagtaaccaacttcaagaatttcaatattccattggaaacc
atctggtctgatatcgattacatggactcatacaaggatttcacaaatgacccacataga
tacccaactgacaagtaccaggacttcttggacaagctacacaagaacaaccaacactat
gttccaatcttcgatgcagcaatttacgttccaaatccaaataatgaaactgacaatgac
tatacccccttccatgccggtaacgaatctgacatcttccttaagaacccagatggctct
ttatacattggtgctgtttggcccggttacaccgctttcccagatttccttgctaacaat
acacaagactggtggaacgagatgtttaaagaatggcacgacagaatcccattcgatggt
atttggtccgatatgaacgaagtcagttctttctgtgttggttcgtgtggtactggcaga
tactttgaaaacccagcagatccaccattcttggttggaggcgaagttactcaatatcca
tcaggtttcaacgtttcgaactcaactgaatggaagtctatttccagttcaattgctgct
acagccactacttctaagcccagtccatcaagctcttctgcttcaatcgactccatgaac
acattgttgccaggtaagggaaacatcaactacccaccttacgctatcaaccacgcccaa
ggtgatcatgatcttgcaactcatgcagtttctccaaatgcaactcatgcagatggcact
gttgaatatgatatccataatctctacggattcttacaagaaaaggctatccacgctgct
ttgttggaaatcttcccaaacaagaggccatttattattgcccgttctaccttctccggt
gctggccattacatgggtcactggggtggtgacaacaatgctgactatgacatgatgtac
ttctctattcctcaggcattcagcatgggtctttctggtattcctttctttggagttgat
gtttgtggtttcaatggaaactcggatgctgaattgtgctcgagatggatgcaattgggt
tcgttcttcccattctacagaaaccacaatgttttgggagccatttctcaagaaccatac
gtttggtcttctgttgctgatgccacgagaacctcaatggctatcagatacttgttgttg
ccatactactataccttgttgcacgaatcacatgttactggtttgccaatcttgagatcc
ttgtcgtggcaattcccatacgagaagaagtacaacggtatcgacaaccaattgtttgtt
ggtgatgccttgattgttactccagttttagaaccaggtgtcaacaagaccaagggtgtt
ttcccaggtgctggtgtctcagaagtctactacgattggtacactcacgaaaagcaagac
ttcagaaatggaaagaatgaaaccttggctgcaccattgggtcacatcccattgcatgtc
agaggtggtcacattttgccacttcaagaaccaggctacactgttgctgaatccagagag
aatccatttgcattgcttgtagctttggacaatgaaggtaatgcttcaggaaagctctac
cttgacgatggggaatctttggaaattgaagaatctttgtatgttgactttgttgctcac
agcaagctgttgacagcatcgagttttggagaatacaatgtttcgcagccattggccaat
attaccatcttgggtgtggagaagaagcctaagcaggtcgaattcgaggattcaaaggtc
aagttcagttacgaaaattcaactattttcgtcacaggtttggaaaagtataccaaagaa
ggtgctttcgctaagcaattcacccttacttggtaa

DBGET integrated database retrieval system