KEGG   Scheffersomyces stipitis: PICST_59212Help
Entry
PICST_59212       CDS       T01023                                 

Gene name
TEL1
Definition
(RefSeq) phosphatidylinositol kinase
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
pic  Scheffersomyces stipitis
Pathway
pic03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pic00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    PICST_59212 (TEL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pic01001]
    PICST_59212 (TEL1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pic03032]
    PICST_59212 (TEL1)
   03400 DNA repair and recombination proteins [BR:pic03400]
    PICST_59212 (TEL1)
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PICST_59212 (TEL1)
Protein kinases [BR:pic01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   PICST_59212 (TEL1)
DNA replication proteins [BR:pic03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     PICST_59212 (TEL1)
DNA repair and recombination proteins [BR:pic03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    PICST_59212 (TEL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase TAN FATC 4HB_MCP_1 PKcGMP_CC
Motif
Other DBs
NCBI-GeneID: 4838569
NCBI-ProteinID: XP_001384387
JGI: 59212
UniProt: A3LT76
LinkDB All DBs
Position
4
AA seq 2904 aa AA seqDB search
MSTLDINRVVSSLQSSKIKDRNDALTLLEDMTSAKFRLNSKQFRILIRGIFDLIKKEAKI
YYNNKLAPVSLRLSRASSAVRIICERAINDMSLQLKFRGYYDLVEGIIANFAADNQQLEP
CSYDFLRILSTVISKNYFKEHLNRDEWKSIFNFVTHLIADILSDMQGIQGISNHGKLLQE
SFSALANLLQCDTHMSISYMHLLDHTIYFRLSSLLEKAAKTLKESVLAITIFKIINKLII
VLATEDFRFVNRLIRLGTNIMSRFYSTQLDKLMNEFLVFLNLSATHNYIDLSKLPKLTDD
NGTMIKESDEDEDDISIRSFVSETRDEPKRLLPFSGKVSADSNEYLVHSIGNLIISLISR
LSMSDFHLDVGCIGILHTETLRRDWFNLNSIYLKSQDHKPWLLCLGLTKLLHSYFCLKQT
VAKTSNMLVLSTILQQQPKKRQKWDTVGIALSNSRNLLEFCNTLIGERQDIREQQVGLQI
LTFYLEAFDLDNEFESEDADSSETPDGTFQSIDKSINDTTFDFTLGESNDNGSFRASIIM
KNILYLFKYSELSFWPLLASNGLIKIKSLNWHSRHHHYSQLLLNIALPLVKNEELFKYSC
NLIFTLVCNSNDLTKKLDESLTSQIDSIIDMVEIVGPFSISTESFLFWYSIAKIVRANNS
AKKFILGERIQDWLLLKWSHFFDVKRNDLQSECQGLAEFIMWISGESVSVRESKYLPDSY
NGSLYEACSFSNYSEDLNEFIALKKPPISSSLSFVIDGISRNNNIEQLMSRILGTVHGFS
TSTLLFEWYFVSQGIYSPLRGMPRFDSVASLFEEQSCEILKTIAVRRMTIEELTHFLSLY
NQIDLDHIFSNRSGYLRSEMKKKFAIVFPFDRLLKTFSEQIVSQFGEEVVVQESRSVFDE
EFSDVNRSSPVPSLGSSAQEYCGFQLDYEKVPCIEVLKFIFVTHKYIEKDVGVTFTVVCT
YFDDLPPNQLVYAFHALVKEFETNSFDILSVPLDLLGRLVRIFGEKILVDQNYERSELTL
TTISQFLKIVLPIVIKATDENFKKDYYDMCMWLIQCGTKDLILTEVAMTSFCEFIIRFVD
LNDETFMTTNQLTSIFLLKFSNCSNSNKIDLVPHLVMLLKSSTSLSQANLYSELFMNFST
PEESIETCATYAMFFSSLTLSSSQVMLSSLFNLLECSRFKFFVPYLEHGLKMICEFIGIE
KPRVLFKAYKLELLLCWWKFDSLHQFPYFLFGYPDQEKFYLENHKELVSITISTKQDQER
SYESLWLTLSKLRNTDVATLVSESLPLIISIAYTREGIRNAVFNVVLSYLKDSFKQEFID
KHILIVSEIISHTDLTREDLLIDKYNSNKVASTLISKNSKVLNFPGVIMVPLNSSLELMQ
KISEKYGSKKDSFWEPRQIYFIFRRVSLLLLHQSLSNEQKIVVIRKLKLICILGSEHIHN
VQIMSLIVDTLNPFVCVPDLFPEICRFYLLLKVDNFHTYGDNSTLLIVIRMVAVMLNSQN
LPLVDRELSSQLMSYARRIGEKRTIRPILMAAIGQLKRDAASFKNTLSTLTVETYLNDTK
EMSIFTDATFKYILILISLTFETIDEYNDSGKLQNVAKILMQCNSGQFALQTNKFNIWSA
KYLSSYYLHGGWNKSGYAFPSNEYRGIPSAAFQSEVNSLNPLVKEVIAHSLSDDFEVAAC
AESILGVLMYKYERSKSEISKFLDFDDIYRQLEGHITPLDFHACILLNDEYELDFLGDTL
SYVINNLDSLISTSSFGIWSTRLFLAINQELASSTSIAPLISTFAAKVNSFSAKQLPNLI
CFYLLTKGKVAIKNIRMLLSQFSSIRTKDTMCISFFLDVVLYLRMGAQMGLGQFVDVTRD
LDVVSFSEMAASINRYKTSMMLLEACFYEDPKRSILVSNTLTRKVYESIDDEDLIFGLKE
EPSLDFVLSMVNRNSSSMEQLAFSSAIFDSSIALSFGSRPTNILQSMNSSGMLGVSRILS
NSTSLFQLQDQVYDWGWKLNSWDIPIPKDAITEQEIVYKVLKQVHDYPYRSLEVCQETLV
DVLLKKDRLINDSLSSKDYRLNTMVWMKSLATISSIESLFTKDVKDLNEIVFGFDKETDW
FEKSDSSLSESIILARRIAFQILADYPVEARNISQENAWLGVLNYLVRYNKLTSSSKEVQ
KMINAMICADSVAKTKLQEVKGIKELVEFVSACTLWSNGQTSIPVAMISTESMNKGIDSP
LTNYNHSETYLKALTVRWLSESRQAAPDFIMEEYVRPISEKALELSDGSEQRKIFQMLAK
YCENQYKSRNLNEEISKLEKQVMEKKVEIEELKAHYGRTSVPAEEKKSVQRFYSKLKNQL
SSEVSDLERAKRSREDFSERAIQYYLESIGWDNQEPLDKFLALWLELSFKDELNDKLRLQ
ILGIPSYLLVNLSTQLISRLANESTEFQRTLSEIVHKICTAHPYHTLYQLFSLMNEKLTS
DSKDAIMGSKRAAARKIWNRLLSADTIFVSQTLKPIESFCLEASILSAHKVSRGKSLHLE
KLDIGNYWLHGLSRIPPPTKDLAVDQNSNYRDVPVLAKIDEKVSIAASGLSLPKIATFTL
SDGTTHRMLLKHGTDDLRQDSIMEQVFEKVNQIFIKDKDAAKRNLTIRTYKAVPLGPTAG
IIEFVANSIALIDIIKPYHLKYDKIKLEKARELMKECQSGEKLERQRVFRHITDKIKPVL
HHFFMDTFLTPDVWFDSRIAYTRGIATTSIVGHILGLGDRHCNNILLDKSTGEPIHIDLG
VAFDQGTRLPIPETVPFRLTRDIVDGFGSTGVEGVFKRSCEHTFRVLQENKENILSILEV
LRWDPLYSWSISPIRKKKLQEEGGGVTSVKLQEDGSEAGRAVLGVANKLAVGGLSVEATV
RELVQEASSPDNLALIYFGWCPFY
NT seq 8715 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccctcgacatcaacagggtagtgtcgtcgttgcagctgtctaagatcaaagac
cgcaatgatgctttgacattactagaagatatgactctggctaagttcagacttaactct
aaacaattccgaattcttattcggggcatatttgacttgataaagaaagaggccaaaatc
tactacaacaacaaattggcaccagtactgcttcgattgagtcgggcctcctctgctgta
agaatcatatgtgaacgggccatcaatgatatgtcgttacagttgaaatttcgtggctac
tacgatttggtagaaggaatcatagccaatttcgccgcagataaccaacaactagagccg
tgttcgtacgatttcctaagaatcttatctactgtgatttccaagaattacttcaaagaa
cacttgaatcgtgatgaatggaaactgatcttcaacttcgttacccacttgatagcagac
atcttgagcgatatgcaaggtatacaaggcatatcgaatcatggaaaattgttacaggag
ctgttttcagcattggccaatcttcttcaatgtgacacgcatatgtctattagctatatg
catttgctagaccatacgatttactttagacttctgagtcttttagagaaagcagctaag
actcttaaagagtctgttctagctattaccattttcaagattatcaataaactcattata
gttctcgctactgaagactttcgctttgtaaatagacttattcgtttgggaactaacata
atgctgcgcttctatctgacccagttggataagctcatgaatgagttcttggtctttctc
aacctttccgctactcacaactatattgatctactgaagcttcccaagctcacagacgat
aatggtactatgataaaagagtctgacgaagatgaagatgacattctgattcgttccttt
gtaagcgaaactcgcgatgaaccaaaacgattgttgccattcagcggaaaagtgtctgca
gattccaacgagtacttggttcacagtattggtaaccttataatcagccttatatcacgt
cttctgatgtcggattttcatctagatgtaggatgcataggaatactacacactgagaca
cttcgacgagactggttcaacttaaactccatatatttgaagtcacaagatcataaaccg
tggctactctgtctcgggctcaccaagttgcttcactcgtatttctgtttgaaacagacc
gtagccaaaacatctaatatgttggttttgtcgaccatcctacaacagcagcctaagaaa
agacagaaatgggataccgtaggaattgctttgtccaactcgcgaaatttgttagaattc
tgtaacacattgattggcgaacgtcaggacattcgtgaacagcaggttggtttgcagatc
ttgactttctaccttgaagcgtttgatcttgataatgagtttgagtctgaagatgctgat
agctcagagacaccagatgggacatttcaatcaatagataaaagtattaacgacacaact
tttgatttcactttaggcgaatccaacgacaatggaagtttcagggcttcaattatcatg
aaaaacatattgtatttgttcaagtattctgagttgagcttctggcctcttcttgcaagt
aacggtttgatcaagatcaagtctttgaattggcattctcgtcatcatcattactctcaa
ctattgttaaacattgctttgccattggtgaagaatgaggagttgttcaagtactcctgc
aatctcatattcactttggtttgtaactcaaatgatttgaccaagaaactagatgaatcg
ctcacatctcagatagacagtatcatagatatggtagagatagtaggtccattctcgatt
tctacggagagctttctattttggtattctatagccaagattgtcagagccaacaatctg
gcgaagaagttcatattaggcgagagaatccaggactggttgttattgaaatggagccat
ttcttcgatgtaaaacgcaatgaccttcaactggaatgtcagggtcttgctgaattcata
atgtggatctctggtgagagcgtttcagtccgcgagtccaagtatctaccagatagctac
aatggctctctatacgaggcgtgttcatttctgaattatagtgaagacttgaacgaattc
attgccttaaagaaacctcctatttcatcttcgttactgtttgtcatagatggaataagt
cgcaacaacaatattgaacaattaatgctgaggatattgggaactgttcacggattttct
acctcaacattattgtttgaatggtactttgtgtctcaaggaatttacagtcctctaaga
ggaatgccacgatttgacagtgtagcgtctttatttgaagagcaaagttgtgaaatattg
aagacgattgcggttcgaagaatgacaattgaggaattaacgcactttttgctgttatac
aatcaaattgatcttgatcacatcttcagtaatagaagtggatatttaagatctgagatg
aagaagaagttcgctatagtattcccttttgatagactattgaagacattctctgagcaa
atagtgctgcaatttggtgaagaagtggttgttcaagagtcaagaagtgtatttgacgag
gaattttcggatgttaatagaagtagtccagtaccttctcttggatcatcggctcaggag
tattgtggttttcagttagattacgagaaagtgccttgtatcgaagttctcaaatttata
tttgtcacacacaagtatattgaaaaggacgtgggagtcaccttcacagttgtctgtacc
tattttgatgatttgccgccaaaccaattggtatacgcatttcacgctttggttaaagag
tttgaaacaaattcatttgacattttgtccgtacctttagacctacttggaagattagtt
agaatatttggtgaaaagatattggttgatcagaactatgagcgatcagaattgacatta
accactatttcacagtttttgaagatagtgttgcctattgttatcaaagctacagatgag
aacttcaagaaggactactatgacatgtgtatgtggttaatacaatgtgggactaaagat
ttgattcttaccgaggttgcaatgactagcttttgcgaatttataattcgattcgtggac
cttaatgacgagacatttatgactaccaaccagcttacatctatattcctcctcaaattc
tccaattgttctaattctaacaaaatagaccttgttccccatttagtgatgctattgaaa
tcttccacttctttatcacaagcaaacttatacagtgaattgttcatgaatttctcaact
ccagaggagtcaattgaaacctgcgcaacgtacgcgatgttctttagtagcttgactcta
agctcatctcaggtcatgctttcatcattatttaacttgcttgaatgttctaggtttaaa
tttttcgttccatacttggaacatggcttgaaaatgatttgtgaatttattggcattgaa
aaaccaagggtgttgttcaaagcctacaaacttgagcttctcttgtgttggtggaaattt
gacagcttgcaccagtttccgtatttcttattcggctatcctgatcaagaaaagttctac
ttggaaaaccacaaagagttggtttccataacaataagtaccaaacaagaccaagaaaga
tcttacgaatcgttatggctaacattatcgaaactcagaaatacagacgtggcaactcta
gtttctgaaagcttaccgcttataatttccattgcctatacaagagaagggataagaaat
gctgttttcaatgtcgtcttgtcctatttaaaagattctttcaaacaggagtttattgat
aagcatatcctaattgtttctgagataattagccacactgatttaacgagagaagactta
ctaattgataaatacaattccaataaagttgcaagtactttgatttcaaagaattctaaa
gtcttgaattttcctggagtgataatggtgccgttgaattcgtcgttggagctaatgcag
aaaatttcagaaaagtatggatctaagaaggatagcttttgggaaccgcgacagatatac
tttatatttcgtcgggtttctctacttcttcttcatcaatcgctttccaatgagcagaaa
attgtagtaattcgaaaacttaaattgatctgcattcttggtagtgaacatattcataat
gtgcaaattatgagcctaatagtggacactttaaatcctttcgtctgtgttcctgaccta
tttcctgagatttgtcggttttacctcctcttaaaagttgacaatttccacacgtatggt
gacaactccacccttcttattgtcattcgtatggttgctgttatgttaaatctgcaaaat
ttacctcttgtagatagagaattaagttctcaattaatgagctacgcaaggagaattggc
gaaaagagaacgattagaccaatattgatggctgcaattggacagttgaaaagagatgct
gcatcatttaagaatactctttctacgttaaccgtggagacttatctcaatgacactaaa
gaaatgtccatattcactgatgctacatttaagtatatcttgattttaatttccttgact
tttgaaacaatcgatgaatacaatgatagtggcaaactccaaaatgtcgccaagatcttg
atgcaatgcaatagtggtcaattcgctcttcaaactaacaaattcaatatctggagtgca
aagtacttgtcatcctattatttacatggtggatggaataagtcggggtatgcgtttcct
tcaaatgaatatcgcgggattccatcagcagcattccaatcagaagtcaacagtttaaat
cccttagttaaagaagtcatagcacactctttaagtgacgacttcgaggttgctgcttgt
gcagaatcgattttgggggtattgatgtacaaatacgaacggtcgaagtcagaaattctg
aagtttctcgattttgatgatatttacagacaacttgaaggtcatattacaccacttgat
tttcacgcatgcatcttgctcaatgatgaatatgagttagattttcttggagatacatta
agttatgttatcaacaatcttgacagtcttatctccacttccagtttcggtatttggtct
accagattgtttcttgcgataaatcaagaattggctagttccacctcaattgctccgttg
atttcaacgtttgctgcaaaagttaattctttttctgccaaacaattacctaatttgata
tgtttttatcttcttacaaaaggtaaagttgctatcaagaatataaggatgttgttgtct
caattctccagtatcagaaccaaggatacaatgtgtatttcattctttctagatgtcgtc
ttgtatctacgaatgggagctcaaatgggtctcggtcaattcgtggatgtcactcgggac
ttagatgtggtatcatttagtgaaatggcagcatcaattaatagatataaaacttccatg
atgcttctcgaggcatgtttttatgaagaccccaaaagaagcatattggttagtaatact
ctaacaagaaaagtctatgaatcaatagatgacgaggatttgatctttggattgaaagag
gagccatcattggattttgtgttgtcaatggtgaatagaaattcgtcttccatggaacaa
ttggcattcagcagtgccatttttgattcgtcgattgcgttaagctttggaagtcgacca
acaaatattcttcaatcaatgaatagcagtggtatgttgggtgtgtctcgaatattaagt
aattccaccagcttatttcaactccaggatcaggtatatgattgggggtggaaattgaac
agttgggacatcccgataccgaaagatgccatcacagaacaggaaattgtctataaagtc
ttgaaacaggtccatgattatccctaccgttccttagaggtttgtcaagaaacactcgtt
gatgtgctattgaaaaaggatagactaattaatgattctttgagcctgaaggactacaga
cttaacacaatggtgtggatgaagtcattagcaactatatccagcattgaaagtttgttc
acgaaagatgttaaggatttaaatgaaattgtgtttggcttcgacaaggaaactgattgg
tttgaaaagtcagatagctctctttccgaaagtatcattttggcgagacgaattgcattt
caaatattggcagattaccctgttgaagcaagaaatatctctcaggagaatgcatggctc
ggggtactcaactacttggtaagatataacaaattgacaagtagttccaaggaagtacag
aaaatgatcaatgctatgatttgtgctgattcggtagccaaaacaaaacttcaagaagtg
aaaggtatcaaggagcttgttgagttcgtctctgcgtgtactctatggtccaatggacaa
actagtattcctgtcgccatgatctctactgagtctatgaataagggtattgattctcct
cttacgaactacaatcattcggaaacgtatctcaaggcactcactgttcgctggttatca
gagtcaagacaggctgcgccagacttcattatggaagagtatgtaaggccaatctctgaa
aaagctcttgaattgtcggatggcagcgagcaaagaaagatattccaaatgctagcaaaa
tactgtgagaatcagtataagtcgaggaatttgaatgaagaaatttcgaagttggagaaa
caggtgatggaaaaaaaggtggaaatcgaagaattgaaggcacactatggacgcacaagt
gttccagctgaagagaagaaatcagttcaaagattctattcgaaattgaaaaatcagttg
ctgagtgaggtatctgacttggaaagggcaaagcgaagcagagaagacttttccgaaagg
gcgatccaatactacttggaaagtattggatgggataaccaggagcctttagataagttc
cttgctctttggttggaattgtcgtttaaagatgagttgaatgataagttgcgtttgcaa
atccttggaattccttcgtacctcttggttaatttgagcacacaattgatttcgagattg
gctaatgagagcacagagttccagagaacgttgtcagaaattgtccataagatatgtact
gctcatccctaccacacattgtatcaacttttctccttgatgaatgagaaacttacaagc
gatctgaaagatgctataatgggttccaaacgtgcggcagcccgcaaaatctggaataga
cttctttcagccgatacaatatttgtttcccagactttgaaaccaattgaatctttctgt
ttggaagcatctattctttcggctcacaaggtgtctcgaggaaaatcgttgcacttggaa
aagttggatattgggaattactggctacatggcttgtcaagaataccaccaccaacaaag
gatctcgcagtagatcagaacagtaattatagagatgttcctgtccttgctaaaattgat
gagaaggtttcaattgctgcttcagggttgagtttgcccaaaattgctacattcaccctt
tcagatggtacgactcataggatgttattgaagcatggtacagacgacttacgccaagac
tcaattatggagcaggtatttgagaaggttaatcaaattttcattaaagacaaggatgct
gcaaagagaaatttgacaatcagaacctacaaggctgttccacttggcccaactgccgga
attattgagtttgtggcgaattctattgcacttattgatattattaaaccttatcatttg
aagtacgacaagataaaacttgaaaaggcaagggaattgatgaaagaatgccagtcggga
gaaaaattggaacgtcaaagagttttcagacatatcacagacaaaatcaaaccagttcta
catcatttctttatggatacatttctcactcctgatgtttggtttgatagtaggatcgct
tacacgagaggaattgcaacaacctcaattgttggccatatattgggtttgggggatagg
cactgtaataatatcttattggataaaagtactggcgagccaatccatattgatcttggt
gtggcctttgaccagggaactagattgcccatcccagaaaccgttccgttcagattgact
agagacatagttgacgggtttggaagtactggtgtggaaggtgttttcaaaaggtcttgt
gaacacaccttccgagtgttgcaagaaaacaaggagaacatcttgtctattcttgaagtt
ttgagatgggatccgttgtattcgtggtccatatcccctattcgtaagaagaaattacag
gaagaaggtggcggcgtcactagtgtaaagcttcaagaagatggttctgaagctggcaga
gcagttcttggtgtggccaacaagttggctgtaggtggactcagtgtggaagctacagta
agagaattggtacaagaagcttcaagccccgacaatttggcacttatatactttggctgg
tgtcccttctattga

DBGET integrated database retrieval system