KEGG   Scheffersomyces stipitis: PICST_66251Help
Entry
PICST_66251       CDS       T01023                                 

Gene name
SDH1
Definition
(RefSeq) succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00020  Citrate cycle (TCA cycle)
pic00190  Oxidative phosphorylation
pic01100  Metabolic pathways
pic01110  Biosynthesis of secondary metabolites
pic01130  Biosynthesis of antibiotics
pic01200  Carbon metabolism
Module
pic_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pic_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pic_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PICST_66251 (SDH1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PICST_66251 (SDH1)
Enzymes [BR:pic01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PICST_66251 (SDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 4850855
NCBI-ProteinID: XP_001387286
JGI: 66251
UniProt: A3GF06
LinkDB All DBs
Position
1
AA seq 641 aa AA seqDB search
MLSSFRSNFKTSAIQRRFLSSTAVRHQVIGSNVKGADFNAAKYMSQKYHVIDHEYDCVVV
GAGGAGLRAAFGLAEAGFKTACISKLFPTRSHTVAAQGGINAALGNMHKDDWHWHMYDTV
KGSDWLGDQDAIHYMTKEAPQSIYELENYGVPFSRNEEGRIYQRAFGGQSKEYGKGGQAY
RTCAVADRTGHALLHSLYGQSLRHDTHFFIEFFAMDLMMQDGECIGVMAYNQEDGTLHRF
RAHKTVIATGGYGRAYFSCTSAHTCTGDGYAMVSRAGLPLEDLEFVQFHPSGIYGSGCLI
TEGARGEGGFLLNSEGERFMERYAPSAKDLASRDVVSRAITMEINEGRGVGPKKDHMYLQ
LSHIPAAVLKERLPGISETAHIFAGVDVTKEPIPILPTVHYNMGGIPTKWNGEVLKKNEK
GEDEVVPGLLACGEAACASVHGANRLGANSLLDLVVFGRAVSHTIRDSLTPGAPHKPAPK
DIGYESIANLDKLRNATGSKTTAQIRDDMQHTMQRGCAVFRTQETLDKCVEHITEVDKSF
ADVKTTDRSMIWNSDLVETLELQNLLTCATQTAKSASARKESRGAHARDDYPSRDDENWR
VHTLSYQTASGEEVKLDYRDVIKTTMDENDCKPVPPAVRVY
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcctcgttcagaagcaatttcaagacctctgctatacagagaagattcttgtcg
tcgacagctgtccgtcaccaagtcattggctccaacgtcaagggtgctgatttcaatgct
gccaaatacatgagccaaaaataccacgtgatcgaccacgaatacgactgtgttgtcgtt
ggcgctggaggtgctggtttgagagcagcctttggattggctgaagctggcttcaagacg
gcttgtatctcgaagttgttccctaccagatcgcacacagttgctgcccagggtggtatc
aatgccgctttgggaaacatgcacaaggacgactggcactggcacatgtacgataccgtt
aagggttctgattggttgggagaccaggatgccatccattacatgacaaaggaggctcct
caatcgatctacgagttagagaactacggtgtaccattctcccgtaacgaagaaggcaga
atctaccagagagcttttggtggtcaatcgaaggagtatggtaaaggtggtcaagcctac
agaacttgtgctgtagctgacagaaccggccatgcattgttacactccttgtacggtcaa
tctttaagacacgacacccacttcttcattgagttctttgccatggacttgatgatgcaa
gacggtgaatgtattggtgtcatggcttacaaccaggaagacggtaccttgcacagattc
agagcccacaagaccgttatcgccactggaggttacgggagagcctacttctcgtgtaca
tcggcccacacctgtactggtgacggttatgccatggtttccagagctggtttgccctta
gaagatttggaattcgttcaattccatccttctggtatctacggatccggatgtcttatc
actgagggtgccagaggtgaaggtggtttcttgctcaattctgagggtgagagatttatg
gaacgttacgctccatcggccaaggatttggcttcaagagatgtcgtttccagagctatc
accatggaaattaacgaaggcagaggtgtaggtccaaagaaggatcacatgtacttgcaa
ttgtcgcacattcctgctgctgtgttgaaggaaagattacctggtatttctgagactgct
catatttttgctggtgtcgatgttaccaaggaacctattcctatcttgcctactgtccat
tacaatatgggaggtatccctaccaagtggaacggtgaggttctcaagaagaatgaaaag
ggagaagacgaagttgttccaggtttgttggcctgtggtgaagctgcttgtgcttctgtt
catggtgccaacagattgggtgctaactctttattggatttggttgtttttggtagagct
gtttctcacaccatcagagactctttgaccccaggcgctccacacaagcctgctcctaag
gatattggttacgaatcaattgctaacttggacaaattgagaaacgctactggttccaag
actactgctcaaattagagatgacatgcaacacaccatgcaaagaggttgtgctgttttc
agaacccaagagactttggacaagtgtgtagaacacattactgaagtcgacaagtcgttt
gctgatgttaagactactgaccgttctatgatctggaactccgatttggtagaaaccttg
gaattgcagaacttgttgacttgtgctactcaaaccgccaagtctgcttctgccagaaag
gaatccagaggtgcccatgccagagacgattaccctagcagagacgatgagaactggaga
gtgcacaccttgtcttaccagaccgcttctggagaagaagttaagttggactacagagat
gtcatcaagaccactatggatgaaaacgactgtaagcctgttcctccagctgtccgtgtt
tattaa

DBGET integrated database retrieval system