KEGG   Scheffersomyces stipitis: PICST_79721Help
Entry
PICST_79721       CDS       T01023                                 

Gene name
KGD1
Definition
(RefSeq) alpha-ketoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00020  Citrate cycle (TCA cycle)
pic00310  Lysine degradation
pic00380  Tryptophan metabolism
pic01100  Metabolic pathways
pic01110  Biosynthesis of secondary metabolites
pic01130  Biosynthesis of antibiotics
pic01200  Carbon metabolism
Module
pic_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pic_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PICST_79721 (KGD1)
  Amino acid metabolism
   00310 Lysine degradation
    PICST_79721 (KGD1)
   00380 Tryptophan metabolism
    PICST_79721 (KGD1)
Enzymes [BR:pic01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     PICST_79721 (KGD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 4840878
NCBI-ProteinID: XP_001386444
JGI: 79721
UniProt: A3LZW8
LinkDB All DBs
Position
8
AA seq 1015 aa AA seqDB search
MLKAFRNVVPRGQLLRASARPSLRSMAPLTSSTSIRSTNSIRCFATGTDSFLQGNNSNYI
DEMYDAWRQDPSSVHASWNAYFKNIESSNIPPSQAFQAPPTIVPTVSGGAAGFVPGSNPI
SEDVVTHLKVQLLVRAYQVRGHQKAKIDPLGISFGDNSDTPKELTLDYYGFTDVDLNKQI
TLGPGILPRFAEAGKKSLTLREIIENCEKLYCQSYGVEYVHIPSKEQCDWLRERIEIPQP
FKYSADQKRQILDRLIWSCSFESFLATKFPNDKRFGLEGAEAVVPGMKALIDTSVEFGVE
DIVIGMPHRGRLNMLSNVVRKPNESIFSEFTGSKEFDEGSGDVKYHLGMNYARPTTSGKF
VNLSIVANPSHLEAEDGVVLGKTRAIQQYKNDIGDYKRAMPILLHGDAAFAGQGVVYETM
GFAHLPAYSTGGTIHIIVNNQIGFTTDPRYSRSTLYPSDIAKASNSPIFHVNADDVEACI
FVFNLAAEWRATFHSDVIIDVVGYRKHGHNETDQPAFTQPLMYKKIAEKKSVLEYYTNQL
IQEGTFTTEDISEHKKWVWNLLEDYFAKSKEYVPTSREWLTTPWEDFKSPKELATEVLPH
LPTAVDEETLKKIGKAISEAPEGFEIHRNLKRILNTRNKTVETGEGIDWATGEALAFGTL
ALEGYHVRVSGQDVERGTFSQRHAVLHDQQSEKTYTPLNHLSEEQGAFVISNSSLSEYGV
LGFEYGYSLTSPDALVQWEAQFGDFANTGQVIMDQFIASAESKWKQRSGLVLSLPHGYDG
QGPEHSSGRIERYLQMCNEDQRYFPSPSKLERQHQDCNFQVAYPTTPANLFHLLRRQMHR
QFRKPLALFFSKSLLRHPLARSDLSEFTNDSHFQWIIEDAEYGKTIAPKEEIKRVVLCSG
QVFTALHKKRAAIEDKTTAFIKIEQVHPFPFAQLRDALDSHPNLEDLVWCQEEPLNMGSY
SFVSPRITTTLAETENHKGLTLRYAGRDPSASVAAGSKAMHTAQEEAFLNETFQV
NT seq 3048 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaggcttttagaaatgtcgtgcctcgcggccagctcttgcgggctctggccagg
ccatccctcagatcgatggctcctttgacatcttccacatccatcagatccaccaactca
atccgttgctttgcaactggaaccgactctttcttgcagggaaacaactccaactacatt
gacgaaatgtacgatgcctggagacaagacccttcatcggtgcatgcctcctggaacgcc
tacttcaagaacattgagtcctctaacattccgccctcgcaggctttccaggctcctcct
actatcgttcctaccgttagtggcggtgctgccggctttgtccctggttctaaccccatc
agtgaggatgttgtcactcatttgaaagtgcaattgttggtccgtgcttatcaagtcagg
ggtcatcagaaggccaagatcgacccattgggtatctcgtttggcgacaacagcgatacc
cccaaggagttgaccttggactattatggcttcacagatgtcgacttgaacaagcaaatc
accttgggtccaggtatcttgcctagattcgctgaagccggcaagaagtcattgacattg
cgcgaaatcatcgagaactgtgaaaagctttactgtcaatcttacggtgtcgagtacgtt
cacatcccttccaaggagcaatgtgattggttgagagagagaatcgaaattccacaacct
ttcaagtactccgctgaccagaagagacaaatcttggaccgtttgatctggtcgtgttcg
ttcgaatccttcttggctaccaagttccctaacgacaagagatttggtttagaaggtgcc
gaagctgttgttccaggtatgaaagccttgatcgatacttccgtcgagttcggtgtagaa
gacatcgtcatcggtatgcctcacagaggtagattaaacatgttgtccaacgtcgtaaga
aagcctaacgaatctatcttctcggaattcaccggttccaaagaattcgacgaaggctct
ggtgacgtgaagtaccacttgggtatgaactacgccagacccactacttctggtaagttt
gtcaacttgtccattgttgccaacccttcgcatttggaggctgaagatggtgttgttttg
ggtaagaccagagccattcaacaatacaagaacgatatcggtgactacaagagagccatg
cccatcttgttacatggtgatgctgctttcgctggtcaaggtgtagtctatgaaaccatg
ggtttcgcccatttgccagcctactctaccggtggtactattcacatcatcgtgaacaac
cagatcggtttcaccacggatcctagatactcgagatcgactttgtacccatccgatatc
gctaaagcctccaactcccctatcttccacgtcaatgctgatgatgtcgaagcttgtatc
ttcgtcttcaacttggctgctgagtggagagctactttccattccgatgttattattgac
gttgtaggctaccgtaagcatggtcataatgaaactgatcaacctgcatttacccaaccg
ctcatgtacaagaagatcgctgaaaagaagtctgttcttgaatactacaccaaccagttg
atccaggaaggcaccttcaccactgaagacatcagcgaacacaagaagtgggtatggaac
ttattggaagactactttgctaagtccaaggaatacgttccaacttccagagagtggttg
accactccatgggaagacttcaagtctcctaaggagttggctaccgaagtcttgccacac
ttgcctactgctgtagatgaagagaccttaaagaagatcggaaaggccatctcggaagct
ccggaaggttttgagattcacagaaacttgaagcgtattttgaataccagaaacaagacc
gttgaaactggtgaaggtattgactgggctactggtgaagctttggctttcggtacttta
gccttggaaggctatcacgtcagagtatctggtcaagatgtggaaagaggtaccttctcg
caacgtcacgctgtgttgcacgaccagcagtcggaaaagacctacaccccattgaatcac
ttatctgaagagcaaggggcttttgttatctccaactcctccttgtctgaatacggtgtc
ttgggtttcgaatacggttactcgttgacttcgccagatgccttagttcaatgggaagct
caattcggtgactttgctaacaccggacaagtcatcatggatcagttcattgctagtgct
gagtccaagtggaagcagcgttctggtttagtgttgtcattgcctcatggttacgatggt
caaggtccagaacactcgtccggtagaatcgagagatacttgcagatgtgtaacgaagac
cagcgttatttcccatctccatccaagttggaacgtcaacaccaggattgtaacttccag
gtcgcttaccctactacccctgccaacttgtttcacttgttacgtcgtcaaatgcataga
cagttcagaaagccattggctctctttttctccaagtcgttattgcgtcacccattagcc
agatccgacttgtctgagttcaccaacgactctcacttccaatggatcattgaagacgcc
gaatatggcaagaccattgcaccaaaggaagagataaaacgtgtcgtcctctgttcaggt
caagtattcactgccttgcacaagaagcgtgctgctattgaagacaaaaccactgccttt
atcaagattgagcaggtgcatccattcccattcgcccagttgcgtgatgccttggactcg
caccctaacctcgaagacttggtctggtgtcaagaagaaccattgaacatgggttcgtac
tcgttcgtatctccacgtataaccactaccttggctgaaaccgaaaaccataagggtttg
accttgcgttatgccggtcgtgacccatcggcttctgttgctgctggttctaaggctatg
cacactgctcaagaagaggccttcttgaacgaaaccttccaagtttaa

DBGET integrated database retrieval system