KEGG   Scheffersomyces stipitis: PICST_82654Help
Entry
PICST_82654       CDS       T01023                                 

Gene name
PHO8
Definition
(RefSeq) vacuolar alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00730  Thiamine metabolism
pic00790  Folate biosynthesis
pic01100  Metabolic pathways
Module
pic_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pic00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PICST_82654 (PHO8)
   00790 Folate biosynthesis
    PICST_82654 (PHO8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pic04147]
    PICST_82654 (PHO8)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pic00537]
    PICST_82654 (PHO8)
Enzymes [BR:pic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PICST_82654 (PHO8)
Exosome [BR:pic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PICST_82654 (PHO8)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pic00537]
 Enzymes
  PICST_82654 (PHO8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 4838063
NCBI-ProteinID: XP_001383845
JGI: 82654
UniProt: A3LRY5
LinkDB All DBs
Position
3
AA seq 560 aa AA seqDB search
MAQKESDPLLGGEIVENMSVYNSKNVKGSDKNKKRLSLLIHFVTISLLGYLFFFGSSRSS
ETAKVDPFKKKNVIFMVTDGMGPASLSLARSFRQHRDQLSINDILTIDKYLIGSSRTRSS
NSLVTDSAAGATAFSCALKSYNGAIGVTPNKQPCGTILEALKLQGYMTGLVVTTRITDAT
PAAFSAHADYRFQEDLIAQHQIGEYPLGRSVDLILGGGRCHFYPSSVPGGCRSDARNLIE
EVQDAATWNYVGNRQEFDLLQQGHNVSLPLLGLLADTDIPYDIDRDSKVYPSLAEQVQVA
LTALTKATENSDKGFFLLIEGSRIDHAGHHNDPAAQVREVLAYDAAFQEVIRYIDESETE
TVVISTSDHETGGLVTARQVTENYPDYLWYPEVLLKSSHSGDFLAHKIVSFKDKNDLKAL
EKFVTKEVLEKDMGITSYTKEEVKQIIDKRNDQGRLLYVLNNILSLRSQTGWTTHGHSAV
DVNIYAYTNSPAIKKKLYSHREYEGLLGNHENIEIGAFLEAITGVDLQKVTKLVQNTEHS
PKKAGADQYSADEFHHNLYQ
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggcccagaaggaaagtgacccgcttttgggcggcgaaatcgtcgagaacatgtctgtc
tacaacagtaagaatgtcaaagggagtgataagaacaagaagagattatcgcttttgatc
catttcgtgaccatctctctcttgggctacttattcttcttcggtagctccagatctagc
gaaactgccaaagtcgatcccttcaagaagaagaacgtcattttcatggtcacggacgga
atgggacctgcctcgttatcgttggccagatccttcagacagcacagagaccagttgtct
atcaacgacatcttgaccatagacaagtacttgatcggctcgtccagaacgagatccagc
aactcgttggtcactgactctgctgctggcgccacagccttttcttgcgccttgaagtcg
tataatggagccattggtgtcactcctaacaagcaaccatgtggtactattcttgaagcc
ttgaagttgcagggttacatgactggtttggtagtgactaccagaatcaccgatgccact
cctgctgccttcagtgcccatgctgactacagatttcaagaggacttgattgcccagcac
caaattggcgagtatcccttaggaagatctgtagacttgatcttgggaggaggcagatgc
cacttctatccatcttcagttcctggtggatgtcgctctgacgccagaaacttgattgaa
gaagttcaggacgctgcaacatggaactacgttggcaatagacaagagtttgaccttttg
caacagggccacaacgtttctttgccattattgggcttgttggccgacacagacattccg
tacgacatcgatcgcgactctaaagtgtacccttctttggctgagcaggtccaggtcgct
ttgactgctttgactaaagctactgaaaactccgataagggtttcttcttgttgattgaa
ggttctagaatcgaccatgccggtcaccacaacgatcctgctgcccaggtaagagaagtt
ttggcttacgatgctgctttccaggaagttattagatatattgatgagtcagaaacagaa
actgtagttatttctacttctgaccacgaaacaggtggtttagtcactgctagacaagtc
accgagaactacccagactacctctggtacccagaagttttgttaaagagctcccattct
ggtgacttcttggcacacaagatcgtttctttcaaggacaagaacgatctcaaggctttg
gagaagtttgtcaccaaggaagtcttggaaaaggatatgggcataacttcatacactaaa
gaggaagtgaagcagattattgacaagcgtaacgaccaaggaagattattgtatgttttg
aacaacatcctttcgttgagatcccaaactggctggaccacacatggccactctgctgtt
gatgtcaatatctacgcctacaccaactccccagccatcaaaaagaagctttattcccat
agagaatacgagggcttgttaggtaaccacgagaacattgaaattggtgcattcttggaa
gctatcactggcgtcgacttacagaaggtcaccaagttggtgcagaacaccgaacattct
ccaaagaaagccggcgcagatcagtattcggcagacgaatttcaccacaatctctaccaa
taa

DBGET integrated database retrieval system