KEGG   Scheffersomyces stipitis: PICST_85453Help
Entry
PICST_85453       CDS       T01023                                 

Gene name
HXK1
Definition
(RefSeq) Hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00010  Glycolysis / Gluconeogenesis
pic00051  Fructose and mannose metabolism
pic00052  Galactose metabolism
pic00500  Starch and sucrose metabolism
pic00520  Amino sugar and nucleotide sugar metabolism
pic01100  Metabolic pathways
pic01110  Biosynthesis of secondary metabolites
pic01130  Biosynthesis of antibiotics
pic01200  Carbon metabolism
Module
pic_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pic_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PICST_85453 (HXK1)
   00051 Fructose and mannose metabolism
    PICST_85453 (HXK1)
   00052 Galactose metabolism
    PICST_85453 (HXK1)
   00500 Starch and sucrose metabolism
    PICST_85453 (HXK1)
   00520 Amino sugar and nucleotide sugar metabolism
    PICST_85453 (HXK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PICST_85453 (HXK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pic04131]
    PICST_85453 (HXK1)
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     PICST_85453 (HXK1)
Membrane trafficking [BR:pic04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    PICST_85453 (HXK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 YcgL
Motif
Other DBs
NCBI-GeneID: 4840806
NCBI-ProteinID: XP_001386689
JGI: 85453
UniProt: A3M060
LinkDB All DBs
Position
8
AA seq 482 aa AA seqDB search
MVHLGPKPPQHRKGSLHDVPEALLKELEQLESVFNVSAETLRKITDHFVLELEKGLSKKG
GNIPMIPGWVLDFPTGKETGDYLAIDLGGTNLRVVLVKLGGNRDFDTTQSKYPLPATMRT
AKSEELWDFIAGCLKKFVEDEYPEGVTEPLPLGFTFSYPASQSSINEGFLQRWTKGFDID
GVEGRDVVPMLQEAIKKENVPIEVVALINDTTGTLVASAYTDPETKMGLIFGTGCNGAYY
DVCGEIPKLEGQFHGDVAGESLMAINCEYGAFDNELAVLPRSKFDHQIDAESPRPGQQAF
EKMISGYYLGEVLRLALLDLSAKGIFFKDQDLSKLNQPFILDTSFPARIEEDPYENLSDV
QDLFQQELGIQTTDAERSVIRRLAEVIGERSARLSVCGIAAICKKRGYKTAHAAADGSVF
NKYPGFKERAAKGLRDIFQWETKEDPIIIVPAEDGSGVGAAVIAALTEKRLREGKSVGAK
KN
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggttcacttaggtcctaagcctcctcagcatagaaagggttcgttgcacgatgttccc
gaagcgcttctcaaagaattggagcagcttgagtctgttttcaatgttagcgcagaaact
cttcgcaagatcaccgaccactttgtcctcgaattagagaagggtttgagcaagaaaggc
ggcaacattcccatgatacccggctgggttcttgactttccaaccgggaaagaaacgggt
gattaccttgccatagatttgggaggaaccaacttgcgagttgttttggtcaagcttgga
ggaaacagagatttcgacaccactcagtccaagtacccattgccagctaccatgagaaca
gcaaagagcgaggagttgtgggacttcatcgctggttgtttgaagaagtttgtggaagac
gaatacccagagggagtgactgagccattgccattgggtttcactttctcgtacccagca
tcgcagagttctatcaacgaaggtttcttgcaaagatggaccaagggttttgacattgac
ggagttgaaggtcgcgatgtcgttccaatgttgcaagaagctatcaagaaggaaaacgtt
cctattgaagttgtagccttgatcaacgataccaccggtactttagttgcttccgcctat
accgaccctgagaccaaaatgggtttgattttcggtacaggctgtaacggtgcttattac
gatgtctgtggcgagattcccaagttggagggccagttccacggcgatgtagctggagaa
tcgttgatggctatcaactgtgaatacggagctttcgacaatgaactcgcagttttgccc
agatccaagtttgaccaccagatcgacgctgaatcacctagaccaggccagcaggctttt
gaaaaaatgatttctggctactacttgggtgaggtgttgagacttgccttattggacttg
ctggctaagggaatatttttcaaagaccaggacttgtccaagttgaaccagcctttcatt
ttggacacttcttttccagccagaattgaagaagacccttacgaaaacttgtcagacgtc
caagacttgttccagcaagagttgggtatccagacaaccgatgctgaaagaagtgttatt
cgccgtttagcagaagtaattggagaaagatcggctagattgtcagtatgtggtattgct
gctatctgtaagaagagaggctacaagaccgcccacgctgccgctgacggttctgtcttc
aacaagtaccctggcttcaaggaaagagctgctaagggattgagagacatcttccaatgg
gagaccaaggaggatccaatcatcattgttccagccgaagatggttctggagtaggtgct
gctgtcattgcagccttgaccgaaaagagattgagagagggtaagtccgtaggagcaaag
aagaactaa

DBGET integrated database retrieval system