KEGG   Phytophthora infestans: PITG_04678Help
Entry
PITG_04678        CDS       T01333                                 

Definition
(RefSeq) phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase, putative
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
pif  Phytophthora infestans
Pathway
pif00562  Inositol phosphate metabolism
pif01100  Metabolic pathways
pif04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:pif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    PITG_04678
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    PITG_04678
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pif01009]
    PITG_04678
Enzymes [BR:pif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PITG_04678
    3.1.3.48  protein-tyrosine-phosphatase
     PITG_04678
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     PITG_04678
Protein phosphatases and associated proteins [BR:pif01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    PITG_04678
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase Phage_lysis
Motif
Other DBs
NCBI-GeneID: 9475800
NCBI-ProteinID: XP_002905416
UniProt: D0N1S8
LinkDB All DBs
AA seq 421 aa AA seqDB search
MSSPSSSPTSSRRYTGGLTYRLKHLVSKEKRRFSSDGFDLDLTYVTQRLVALGYPAEKIE
GIYRNHYRDVFRFFEQRHPGRYRVYNLCVERRYAPDEKFHGRVAEFGFEDHCPPPLSLLL
PFCRDVHVWLTTDPENVVAVHCKAGKGRTGVMLCAYMLYARKWRSAHGALEYFAAARSKK
LQGVTILSQRRFVRYFSELCRRSESADDLVELGPYEEEEARERAMALTDYHAQWLQETQT
LPEPSSPRKIIGSKLRPHAEPMLPTRVNLVLVAVMLCGVTGHKKTSSSAAEWRVRVECGA
IRPRAAVYDLVGSFQRQRRPSTDDGNSEETVELEMRCSPVLVWDEVKVELRRRTGSVLGH
FWFHTAFISQVDGHYELALAKSEIDKIAKDVKHGHKQFAPEFAVRLRFELAEEQGMARLD
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaccttcttcgagcccaacttcatccagacgatacactgggggcctcacctat
cgcctcaagcatttagtgtcaaaggagaaacgtcgattctcctccgacggctttgattta
gacttgacgtacgtcacccagcggctcgtggcattggggtatccggcggaaaagatcgag
ggtatctaccggaaccactatcgcgacgtctttcgcttcttcgaacagcgccatcctgga
cggtaccgcgtgtataacctctgcgtggaacgccggtacgcacccgatgagaaattccac
ggacgggtagctgaattcggcttcgaagaccattgcccaccccctctgtcgctgttgctc
ccattctgtcgagacgtccatgtgtggctgacgactgaccctgaaaatgtcgtggcggtg
cactgcaaggctggcaaaggccgaaccggagtcatgctgtgtgcctacatgctgtatgcg
cggaaatggcggtctgctcacggagcactcgagtactttgctgctgcacgctcaaagaag
ctgcaaggcgtgacaattctgagccagcggcgattcgtccgctatttcagcgagctatgt
cgtcgctctgaaagtgccgatgacctggtagagctcggaccctacgaggaggaagaagct
cgcgagcgagccatggcgttgaccgactaccatgcacaatggctgcaagagactcaaaca
ctacccgagccttcttcaccacgaaaaatcattggatctaagctaagaccgcatgctgag
cctatgctcccaactcgtgtcaacctcgtgcttgtcgccgtcatgctgtgcggcgttact
ggccacaagaaaacgagttctagtgctgccgagtggcgagtacgagtcgagtgcggggct
attcgccctcgtgcagctgtctacgacctggtcggaagcttccagcgtcaacgacgcccc
agcactgacgatggcaacagcgaagagaccgtggaattggaaatgcggtgcagcccggtg
cttgtttgggatgaggtcaaggtggagctccggcggcgaacgggtagtgtcttgggacac
ttttggttccacaccgcgtttatctctcaagtggatggtcattatgagctggcgctggcg
aagagcgagatcgacaagattgcaaaggacgtcaaacacggacacaagcagtttgctccc
gagtttgcagtgcgtctacgcttcgagctggcagaggagcaaggcatggccagattagac
gcatag

DBGET integrated database retrieval system