KEGG   Phytophthora infestans: PITG_06353Help
Entry
PITG_06353        CDS       T01333                                 

Definition
(RefSeq) hypothetical protein
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
pif  Phytophthora infestans
Pathway
pif00310  Lysine degradation
pif01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pif00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    PITG_06353
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pif03036]
    PITG_06353
Enzymes [BR:pif01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     PITG_06353
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     PITG_06353
Chromosome and associated proteins [BR:pif03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     PITG_06353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-MYND TPR_12 TPR_10
Motif
Other DBs
NCBI-GeneID: 9471502
NCBI-ProteinID: XP_002998487
UniProt: D0N4N2
LinkDB All DBs
AA seq 424 aa AA seqDB search
MRIVSDSAVDASEDVSGDRGRRVETQIDLNAGDLALRASASAAVLLPELWGSHCHKCFAT
GVRLSRCGRCHTAFYCSKACQQADWAPDHRRECKSMAQLAQIGLRSDQVSDVLLLGRVLR
RKGGEGLQPSELVWYEEDMDDQELLLLAALAQKINLVDESFSMDEMARMLSRFRNNNFSI
CDELLLELGAGCFPLGAMINHSCDPNCAVTFVPKTLDMEFRAMKPIKSGEEITQTYVDIA
LPRRERQQRLQRKYHFTCGCPRCSQPLQEPGSLDAYLDADIDGVPQERWTEERQQEQCID
ALQNLADRQSTILHCHSVARLQTLATIFSAEMERGSVEEAIGYGERMLEFYRRVYNPNHP
MTGLHVFTLGDLYGQQAQAGTGAEDSKQKSAEYLAEAQRILQITHGKDHRFVKMLGDRLE
TAST
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgtgagcgacagcgctgtcgacgcgtccgaggacgtctcaggggaccgtggc
cgacgcgtcgagacgcagattgatctgaatgcgggcgatctggctcttcgtgcttccgct
agtgccgccgtgctgctgcccgagctctggggctcgcactgtcacaagtgctttgccaca
ggtgttcggctcagccgctgcggccgctgccacactgccttctactgctccaaggcgtgt
cagcaggctgactgggcgccagaccatcgcagggaatgcaagagtatggcgcaattggcg
caaatcggcctgcgaagtgaccaggtgtcagatgtcctgctactgggacgcgtcttaaga
cgtaaaggtggcgaaggactgcagccttcagagctcgtgtggtacgaagaggacatggac
gaccaagaacttcttctcctggcggcactggcacagaaaatcaacttggtggatgaatcg
ttctcgatggacgagatggcgcgcatgttaagtcgctttcgcaacaacaacttctccatt
tgcgacgagctgctgttggagctaggcgcaggctgcttcccactcggtgcgatgattaac
cacagttgtgatcccaactgcgctgtcacgtttgttcctaaaactcttgacatggagttc
cgagcgatgaagcccatcaagtccggcgaagagatcacgcagacatacgtcgacattgcg
cttccacggcgcgagagacaacaacgtctgcaacgcaaatatcattttacttgcggctgt
ccgcgctgctcgcaacctcttcaggaacctggaagtttggatgcttatctcgatgcagat
attgatggtgttccgcaagagcggtggacagaggagcgccaacaagagcaatgcatcgat
gcactacagaacttggcagaccgtcagagtactattcttcactgtcacagcgttgcacga
ttgcagacgctagcaacgatttttagtgccgaaatggagcgtgggagcgtggaggaagcc
attggatacggggagcgcatgctggagttctatcgacgtgtctacaaccccaaccatccg
atgacggggctgcatgtgtttaccctgggcgacctgtatggccagcaggcacaagcagga
acaggagcagaggatagcaagcaaaaatcagcggaatacctggctgaggcgcagcgtatc
ttgcagatcacccacggcaaggatcatcgcttcgtaaaaatgcttggagatagactggag
acggcgtcgacatga

DBGET integrated database retrieval system