KEGG   Phytophthora infestans: PITG_13712Help
Entry
PITG_13712        CDS       T01333                                 

Definition
(RefSeq) hypothetical protein
  KO
K19947  F-actin monooxygenase [EC:1.14.13.225]
Organism
pif  Phytophthora infestans
Brite
KEGG Orthology (KO) [BR:pif00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pif04131]
    PITG_13712
Enzymes [BR:pif01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.225  F-actin monooxygenase
     PITG_13712
Membrane trafficking [BR:pif04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    PITG_13712
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    PITG_13712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_3 Pyr_redox_2 FAD_binding_2 Pyr_redox_3 DAO HI0933_like NAD_binding_8 AlaDh_PNT_C FAD_oxidored Pyr_redox 2-Hacid_dh_C UDPG_MGDP_dh_N Thi4
Motif
Other DBs
NCBI-GeneID: 9461281
NCBI-ProteinID: XP_002899413
UniProt: D0NML6
LinkDB All DBs
AA seq 571 aa AA seqDB search
MGTKISKFLNRGQASDDECNDSQKSRRFHERFVAGKSSVRLALLATLDQVTRTVQRRDLS
EASMVQISALLTSIDQIAREDMNNKNDQHKRGFRRLSSSQWRKNGNAPIVPTALNSFKAF
DAAQDLGETLAAFSNLLNDCGLNGVKVDEPWHVFFHIKAAVYSKLSFRHKQLFKLLDARF
NLDVYTRKHAARKRVCIVGAGPVGLRAAVETALLGGQVIVLEKREHFSRENMLHLWPWVI
QDLVSLGAKVFFPQFGKSNSHFYVSMRQLQVILLKVALLLGVTIYPATDFESIVPPGLEE
SGGEPFYSVVTQPQIPTMEFTAVLGAAGTNDKLAKPAGINRFVYSDKEALGIVCYFPNLG
TSDEVKAKEFSWTTQQKHPMLDKLRDIGLDLENIVYYRGEMHYLVMTPKRQNLRELHVVN
EDRPSSTDLVMDDNINNSALYEFVKGIVDFAGIPRKTDFTRVSLFDFSSLTRADKAASIL
SSHGKKLYVGLIGDSLHEPVWHDGVGTCSGFLSALDSVWMVAQIGRDPDEQLLVDREAAY
QVTMRVSNNHREDLQKNIRKYTADPRSRYTV
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggggaccaagatttcaaagttcctgaatcgaggacaagcgtcggatgacgaatgcaac
gattcacagaaatctcgtcgcttccacgagcgctttgttgctggtaaatcgtcggttcga
ttggcactgctggcgacgctggaccaggtcactcgaaccgtccaaagaagggatctttcc
gaggcgtccatggttcagatttcagctcttttgacctcgatcgaccagatcgcacgtgaa
gatatgaacaacaagaatgatcaacacaaacgaggattccgacgactgtcgagctcgcag
tggcgcaagaatggcaatgctccgattgtgcctacggcgctgaactcattcaaggctttc
gacgccgcgcaagacttgggagaaactctggcagcattcagcaatctactcaacgactgc
ggtctcaacggtgtcaaagtggacgagccgtggcatgtgtttttccacatcaaggcggca
gtgtacagcaagttgagcttccgtcacaagcagctctttaagctgctagatgcacgcttt
aacctggacgtgtacacaaggaaacatgctgccaggaagcgtgtctgcatcgttggggct
gggccggttggtctccgtgctgcagtcgaaacggcattacttggaggtcaggtgattgta
ctagaaaagcgggaacacttcagtcgagagaacatgcttcacctgtggccgtgggtgatt
caggacttggtatctctcggagcgaaggtcttcttcccgcagtttggcaagtcgaactcg
cacttctatgtcagtatgcggcagctgcaggttatcttgctcaaggtcgcactgcttctt
ggtgtgacgatctatccagccacagatttcgagtctattgtgcctccgggtctggaggag
agtggcggtgaacctttctactcagtggtaactcagccgcagatcccgacaatggagttc
acagcggtgctgggtgctgctggaacgaacgataagctagccaaacctgctggtatcaat
cggttcgtgtacagtgataaggaagctctggggatcgtctgttacttcccgaatcttggg
acttctgacgaggtgaaagccaaggagttctcatggactacccagcaaaagcacccgatg
cttgacaaattgcgtgacattggattagatctggagaacatcgtgtactaccgtggagaa
atgcactatctggtgatgacaccgaaacgtcagaacttaagagagcttcatgtggtaaac
gaagatcgcccaagctcgacagatctggtcatggacgacaacatcaacaacagcgcattg
tatgagtttgtcaagggaattgtcgacttcgctggtatcccgaggaaaacagacttcaca
cgtgtcagtctctttgatttcagctctctcacccgtgcagacaaggctgcgagtatcctc
tcgtcgcatggtaagaagctttacgtcggtcttattggagactcgttgcacgagcccgta
tggcacgatggtgtgggaacttgcagtggcttcttgagtgcattggacagcgtgtggatg
gtggcacagatcggccgagatcccgatgaacagcttctggtcgaccgtgaagccgcatac
caagtgacgatgcgagtgtcgaacaatcaccgtgaagacttgcagaagaatatacgcaag
tacacagctgatccaagatcgcgctacaccgtctag

DBGET integrated database retrieval system