KEGG   Phytophthora infestans: PITG_18354Help
Entry
PITG_18354        CDS       T01333                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit, mitochondrial precursor
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pif  Phytophthora infestans
Pathway
pif00020  Citrate cycle (TCA cycle)
pif00190  Oxidative phosphorylation
pif01100  Metabolic pathways
pif01110  Biosynthesis of secondary metabolites
pif01130  Biosynthesis of antibiotics
pif01200  Carbon metabolism
Module
pif_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pif_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pif_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PITG_18354
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PITG_18354
Enzymes [BR:pif01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PITG_18354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 DAO GIDA HI0933_like FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 9463185
NCBI-ProteinID: XP_002997801
UniProt: D0NXY8
LinkDB All DBs
AA seq 625 aa AA seqDB search
MLRSSQMKQALAKAMARPAATRGFAVRSSTPLAGVETSALTSKYTIVDHEYDAVVVGAGG
AGLRAAMGCAEAGLKTACISKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSD
WLGDQDAIHYMCREAPEAVRELEDFGLPFSRTEEGKIYQRPFGGQSHAMLHTLYGRSLAF
DTSYFIEYFALDLIMNDAGECVGVMAFNMEDGTFHRFHTNNTVLATGGYGRAYFSCTSAH
TCTGDGTGMALRAGIPLQDPEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERY
APTAKDLASRDVVSRAMTMEIREGRGVGKNQDHIFLHLDHLPPELLQERLPGISETAAIF
AGVDVTKEPIPVLPTVHYNMGGIATNHMGEVVVPDVDGMPEPGKLYPDKIVPGLFAAGEA
ACASVHGANRLGANSLLDLVVFGRACALRIAELTKPGEKKRPMPKDGGLKAIEDVDKLRY
ADGSISTAELRDEMQRTMQVDAAVYRTQESLEAGKDKIDEVVPKFNDIKVTDRSLIWNTD
LTETLELRNLLACASCTMHGAEARKESRGAHAREDFTERDDVNWMKHTVAYHDEEGKTHI
GYRSVQDQTLDENECKHVPPFARVY
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgctcctcacagatgaagcaggcgcttgccaaggcaatggcccgtccggctgcc
acgcgcggatttgccgtacgcagctcgacgcctctggccggtgtcgagacgtcggcgctt
acgtccaagtacacgattgttgaccacgaatacgacgccgtggtcgtgggtgccggtggt
gccggcctgcgtgcggccatgggctgtgccgaggctggcctaaagacggcatgtatctcg
aagcttttcccgacgcgttcgcacacggtggccgcccagggaggcattaacgccgctctt
ggcaacatgtcggaggacgattggaggtggcatatgtacgacaccgttaagggaagtgat
tggctcggagaccaggacgctatccactacatgtgcagagaggctcctgaggccgtgcgc
gagctggaggactttggcctgccgttctcccgtacggaggagggcaagatctaccagcgt
cctttcggtggccagagtcacgccatgctgcacacgctgtacggccgctcgctggccttc
gacacttcgtactttatcgagtacttcgctctggatctcatcatgaatgacgctggcgag
tgcgtgggtgtcatggccttcaacatggaggacggcacattccatcgcttccacactaac
aacacggtgctggctacgggtggctacggccgtgcctacttctcgtgcacgtcggcccac
acgtgcacgggtgacggtaccggcatggctctgcgtgccggcatccccctgcaggacccc
gagtttgtgcagttccaccctaccggtatctacggtgccggctgtctcatcaccgaagga
tcgcgtggtgagggcggtatcctgcgtaactcggagggtgaacgcttcatggagcgttac
gcccccacggccaaggatctggcctcgcgtgacgtcgtgtcgcgtgccatgaccatggag
atccgtgagggccgtggtgtcggtaagaaccaggaccacatcttcctacacctggaccac
ctaccgcctgagctgctgcaggagcgtctgcccggtatttcggagactgccgctattttt
gctggcgtggatgtgaccaaggagccgatcccggtgctaccgaccgtgcactacaacatg
ggcggtatcgctaccaaccacatgggcgaagtggtggtgccggacgtggacggcatgccg
gagcccggtaagctgtacccggacaagatcgtgcccggtctgttcgctgccggtgaggct
gcctgcgcttcggtgcacggtgccaaccgtctaggagccaactcgctgctggatctggtg
gtcttcggccgtgcttgtgctctacgtattgccgagctgacgaagcccggcgagaagaag
cgcccgatgccgaaggacggtggcctgaaggctatcgaggacgtggacaagctgcgctac
gctgacggcagcatctcgacggctgagctgcgtgacgagatgcagagaaccatgcaggtg
gacgctgctgtgtaccgtacgcaggagtcgctagaggccggtaaggacaagatcgacgag
gtggtgccgaagtttaacgacatcaaggtgacggaccggtcgctcatctggaacacggac
ctgacggagacgctggagctgcgtaacctgctggcctgcgcgtcctgcaccatgcacggc
gctgaggctcgtaaggaatctcgtggtgcccacgcccgtgaggatttcacggagcgtgac
gacgtcaactggatgaagcacacggtcgcctaccacgacgaggaaggcaagacgcacatt
ggctaccgctccgtgcaggaccagacgctggacgagaatgaatgcaagcacgtcccgccc
ttcgcgcgtgtctactaa

DBGET integrated database retrieval system