KEGG   Pigmentiphaga sp. H8: EGT29_00530Help
Entry
EGT29_00530       CDS       T05719                                 

Definition
(GenBank) hypothetical protein
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
pig  Pigmentiphaga sp. H8
Pathway
pig00620  Pyruvate metabolism
pig01100  Metabolic pathways
pig01120  Microbial metabolism in diverse environments
pig01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EGT29_00530
Enzymes [BR:pig01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     EGT29_00530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M
Motif
Other DBs
NCBI-ProteinID: AZG06465
UniProt: A0A3G8GEB4
LinkDB All DBs
Position
complement(109895..111160)
Genome map
AA seq 421 aa AA seqDB search
MDSSLTDQALAYHQFPIAGKISVVPTKPLDNQHDLSLAYSPGVAAACEAIANDQQATRYY
TSRSNLVAVISNGTAVLGLGNIGPYAAKPVMEGKACLFQKFAGINVFDIELAETDPDKLV
DAIAMMEPTFGGINLEDIKAPECFYIERKLTERMSIPVFHDDQHGTAIVASAGIVNGLKL
AEKSLDQVKLVCSGAGAAAIACLDLLVRQGLKKENILLVDSKGVVYEGRDASMEFNKSRY
ASTSAARTLADAVKDADVFLGCSAAGLLTPEMVSTMALRPLILALANPEPEIRPEVARAV
RSDCLIATGRSDYPNQVNNVLCFPFLFRGALDVEAMRITDEMKLACVNAIANLAQQPIPP
EVAKAYPNHKLEFGPDYFIPTPFDPRLISEVASAVALAAMDSGVARRPIGDIDAYRQSLL
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggattcttcgcttaccgatcaggcgctcgcctatcatcagttccccatcgccggaaag
atctccgtcgtccccaccaagcccctcgacaaccagcacgacctgtcgctggcctattcc
cccggcgtcgccgccgcgtgcgaagccatcgccaacgaccagcaggccacgcgctactac
acgtcgcgctcgaacctggtggcggtcatctccaacggcaccgccgtgctcggtctgggc
aacatcggcccgtacgccgccaagcccgtcatggaaggcaaggcctgcctgttccagaag
ttcgcgggcatcaacgtcttcgacatcgaactggccgagacggaccccgacaagctggtc
gacgccatcgcgatgatggagcccacgttcggcggcatcaatctcgaggacatcaaggcg
cccgagtgcttctacattgagcgcaaactgaccgagcgcatgtcgatcccggtcttccat
gacgaccagcacggcacggccatcgtcgcctccgccggcatcgtcaacggcctgaagctg
gccgagaagtccctggaccaggtcaagctggtctgctcgggcgccggcgccgcggccatc
gcgtgcctggacctgctggtgcgccaggggctgaagaaggaaaacatcctgctggtggac
tccaagggcgtggtctacgaaggccgcgacgcgtcgatggaattcaacaagtcgcgctat
gcctccaccagcgccgcgcgcacgctggccgacgcggtcaaggacgccgacgtcttcctg
ggatgctccgccgccggattgctgacgccggaaatggtctcgaccatggcgctgcgcccc
ctgatcctggcgctggccaatcccgaacccgagatccgtccggaagtggcccgcgccgtc
cgctcggactgcctgatcgcgacgggacgttcggactacccgaaccaggtcaacaacgtc
ctttgctttcccttcctgttccgcggcgcgctggacgtggaggccatgcgcatcaccgac
gaaatgaagctcgcctgcgtgaacgccatcgccaatctcgcgcagcagcccatcccgccc
gaagtcgccaaggcctatcccaaccacaagctggagttcggcccggactacttcatcccc
acgccgttcgacccccgcctgatcagcgaagtcgcgtccgccgtcgcgctggccgcgatg
gattcgggcgtcgcgcgccgtcccatcggcgacatcgacgcctatcgccagtcgctgctg
aagtag

DBGET integrated database retrieval system