KEGG   Pigmentiphaga sp. H8: EGT29_08645Help
Entry
EGT29_08645       CDS       T05719                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pig  Pigmentiphaga sp. H8
Brite
KEGG Orthology (KO) [BR:pig00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EGT29_08645 (ahpF)
Enzymes [BR:pig01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EGT29_08645 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like FAD_binding_3 Glutaredoxin NAD_binding_8 AlaDh_PNT_C Thi4 DAO K_oxygenase NAD_binding_9 FMO-like Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: AZG07939
UniProt: A0A3G8GIK2
LinkDB All DBs
Position
complement(1832302..1833891)
Genome map
AA seq 529 aa AA seqDB search
MLDANLKTQLQAYLEKITQPIEIVASLDDGDKSRELAELLKEIAGLSERITLIERRDDAE
RKPSFTINRPGQDIGIRFAAIPLGHEFTSLVLALLQVGGHPIKLDADVIEQIKNLDGDFS
FETYVSLSCQNCPEVVQALNVMSLLNPRIRQVTIDGALFEDEVEKRQVMAVPTVYLNGEV
FGQGRMSVEEFLAKLDSGAGQRDAEKLSAREPYDVLIVGGGPAGAAAAVYAARKGIRTGV
VAERFGGQVLDTLAIENFISVKETEGPQFATALEEHVKAYDVDIMNVQRAEALVPGAKMI
EVKLANGGVLKGRSVILATGARWREVNVPGEREYRNHGVAYCPHCDGPLFKGKRVSVIGG
GNSGVEAAIDLAGLVEHVTLLEFAPELRADAVLQRKLNSLSNVTVITQAQTTEITGDGKK
VNGLKYKDRQSGDEHHIELEGVFVQIGLVPNTEWLKGTLALSKHGEIEVDARGQTSVPGV
FAAGDVTTVPYKQIIIAAGEGAKAALSAFDHLIRSSVEADAPETAAVPA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatctcaagacccagttgcaggcctacctggaaaaaatcacgcagccg
atcgagatcgtcgcgtccctcgacgacggcgacaagtctcgcgagctcgctgaactcctg
aaggaaatcgccggactgtcggaacgcatcacgctgatcgagcgacgcgacgacgccgag
cgcaagccctccttcaccatcaaccgccccggccaggacatcggcatccgctttgccgcc
attcccctgggccatgaattcacgtcgctggtcctggccctgctccaggtcggcggccac
ccgatcaagctcgatgccgacgtgatcgagcagatcaagaacctggacggcgacttctcg
ttcgagacctatgtgtcgctgtcctgccagaactgccccgaggtcgtccaggcgctgaac
gtgatgtcgctgctgaacccgcgcatccgccaggtcacgatcgacggcgcgctgttcgag
gacgaggtcgagaagcgccaggtcatggccgtgcccacggtctacctgaacggcgaagtg
ttcggccagggccgcatgagcgtggaagaattccttgccaagctcgacagcggcgcgggc
cagcgcgacgccgagaagctgagcgcgcgcgaaccgtacgacgtgctgatcgtcggcggc
gggccggcgggcgcggccgcggccgtctacgcggcgcgcaagggcatccgcaccggcgtc
gtggccgagcgcttcggcggccaggtcctggacacgctggcgatcgagaacttcatctcc
gtcaaggagaccgaggggccccagttcgccaccgcgctggaagaacacgtcaaggcctac
gacgtcgacatcatgaacgtgcaacgcgccgaggccctggtgcccggcgccaagatgatc
gaggtcaagctggccaacggcggcgtgctcaagggccgatccgtcatcctggccaccggc
gcccgctggcgcgaggtgaacgtgccgggcgagcgcgagtaccgcaaccacggcgtggcg
tactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtgtccgtgatcggcggc
ggcaactcgggcgtggaagcggcgatcgacctggccggcctggtcgaacacgtgaccctg
ctggaattcgcccccgaactgcgtgccgatgcggtgctgcagcgcaagctcaacagcctg
tccaacgtcacggtcatcacccaggcgcagaccaccgagatcaccggtgacggcaagaag
gtgaacggcctgaagtacaaggaccggcaatcgggcgacgagcaccacatcgaactcgaa
ggcgtgttcgtgcagatcggcctggtgcccaacaccgaatggctcaagggcaccctggcg
ctgagcaaacatggggaaatcgaggtcgatgccaggggccagacctcggtgcccggcgtg
ttcgccgcgggcgacgtgacgaccgtgccgtacaagcagatcatcatcgccgcgggtgaa
ggcgcgaaggccgcgctcagcgccttcgaccacctgatccgctcgtcggtggaagccgac
gcgccggaaacggctgcagtgcccgcctga

DBGET integrated database retrieval system