KEGG   Pigmentiphaga sp. H8: EGT29_09630Help
Entry
EGT29_09630       CDS       T05719                                 

Gene name
treS
Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pig  Pigmentiphaga sp. H8
Pathway
pig00500  Starch and sucrose metabolism
pig01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EGT29_09630 (treS)
Enzymes [BR:pig01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     EGT29_09630 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     EGT29_09630 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AZG08121
LinkDB All DBs
Position
2036927..2040301
Genome map
AA seq 1124 aa AA seqDB search
MNNKRETSVNAVNRGDPLWYKDAVIYQLHIKSFFDANNDGIGDFSGLLSKLDYIAQLGVD
TIWLLPFYPSPRRDDGYDIAEYRGVHPDYGELADVRRFIAAAHERGMRVITELVVNHTSD
QHPWFQRARHAKPGSAARNFYVWSDNDQAYAGTRIIFIDTEKSNWTWDPVAGAYFWHRFY
SHQPDLNYDNPRVLKAILSVMHFWLDLGVDGLRLDAVPYLVEREGTNNENLPETHAILKR
IRQDLEASYDDRMLLAEANQWPEDAQEYFGQGDECHMSFHFPLMPRMYMAIAREDRFPIT
DIMQQTPDIPGNCQWAIFLRNHDELTLEMVTSSERDYLWEVYAADRRARLNLGIRRRLAP
LMERDRRRIELMHSLLLTMPGTPVIYYGDEIGMGDNIHLGDRDGVRTPMQWSPDRNGGFS
RADPEHLVLPPLMGNLYGYEAVNVEAQSGDAHSLLNWMRRMLGKRRQYRVFGRGGLRFLY
PGNRKILAYLREHEETTILCVANLSHTPQAVELDLAEFDGRVPVELTGGTAFPAVGRLTY
LLTLPPYGFYWFELSASATPPNWHLATADQLREFRTLVLRGKTGYDLTTESRRTLEHDVL
PEYLALRRWFASKHERIVSGRVVYGVRLPAGDELYLTEIEADLGERRERYVVPLGLIWEE
TLPQLQQQLALARVRRGPMVGMVTDAFSLQSFAVAVFDSLRNGVELESRIAASDGGSARI
RFLPEPGLEAVAVDADTPIRWLSAEQSNSSLVAGTAAVLKIVRRVTAGTHPESEMTRHLT
KLGFRNTAALLGEVVRVDEDGTPHTLMLAQQYVDNQGDAWNWTLEYLHRTLDDAALTAES
AEDYGQELRGYATLAAAVGRRLGELHAALALPSEDPAFAPVEASREDVARWVDDTRQSLD
QALAILAARRDWGDLAADTALLLDNRGLLEAAIDRLGQAVGNAWLTRVHGDFHLGQVLVA
QNDAYIIDFEGEPARTMDERRRKRNPLRDVAGLLRSFDYASAVVARAPDATVPAAGANPI
AGPSVDTVAQRRDVLLERFRVEASGAFLDAYREAAAAAPRPWVDSKDEEALLALFLIEKA
AYEVCYEAANRPAWIGVPLRGLVTLAGRIEPAIRREEDLDGQQP
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaagcgcgagacatccgtgaatgccgtcaaccggggcgatccgctctggtac
aaggacgcggtcatctaccagttgcacatcaagtccttcttcgatgccaacaacgacggc
atcggggatttctccggactgctgtccaagctcgactacatcgcgcagctgggcgtggat
acgatctggctgctgccgttctacccctcgccgcggcgcgacgacgggtacgacatcgcc
gagtaccggggcgtgcatcccgactacggagaactggccgacgtgcggcgcttcatcgcg
gcggcccacgagcgcggcatgcgcgtgattaccgaactggtggtcaaccacacgtcggac
cagcatccatggttccagcgcgcgcgccacgccaagccgggctcggccgcgcgcaatttc
tacgtgtggtccgacaacgaccaggcctacgccggcacgcgcatcatcttcatcgacacc
gagaaatcgaactggacctgggatccggtggcgggcgcctatttctggcaccgtttctat
tcccaccagcccgacctgaactacgacaatccgcgcgtgctcaaggccatcctgagcgtg
atgcatttctggctggacctgggggtggacgggttgaggctggacgccgtgccctacctg
gtcgagcgcgagggcaccaacaacgagaacctgcccgagacccatgcgatcctgaagcgc
atccggcaggacctggaggcttcctacgacgaccgcatgctgctggccgaggccaaccaa
tggcccgaggacgcgcaggaatacttcggacagggcgacgaatgccacatgtccttccac
tttccgctgatgccgcgcatgtacatggccatcgccagggaagaccgctttcccatcacc
gacatcatgcagcagacgccggacatacccggcaattgccagtgggcgatcttcctgcgc
aaccacgatgaactgacgctggagatggtgaccagcagcgagcgcgactatctgtgggag
gtgtatgccgccgaccggcgggcgcggctcaacctggggatacgccgccggctggcgccg
ctgatggagcgcgaccggcgccgcatcgagctgatgcacagtctgctgctgaccatgccg
ggcacgcccgtcatctactacggcgacgagatcggcatgggcgacaacatccatctgggc
gaccgcgacggcgtgcgcacgcccatgcaatggtcgcccgaccgcaacggcggtttctcg
cgcgccgatcccgagcacctggtgctgccgccgctgatgggcaacctgtacggctacgag
gcggtcaacgtcgaggcccagtccggcgatgcccattcgctgctgaactggatgcgccgc
atgctgggcaagcggcgccagtaccgcgtattcgggcgcggcggcctgcgtttcctctat
ccgggcaaccgcaagatcctggcgtacctgcgcgagcacgaggaaaccaccatcctgtgc
gtggccaacctgtcgcacacgccccaggcagtggaactggacctggcggagttcgacggc
cgggtgccggtcgagctgacggggggcacggcgttccccgccgtcggccgcctgacctac
ctgctgaccttgccgccctatggcttctactggttcgaactgagcgcctcggcgacgccg
ccgaactggcacctggccaccgccgaccagttgcgcgagttccggaccctggtgctgcgc
ggcaagacgggctatgacctgacgaccgaatcgcgccgcacgctggaacacgacgtgctg
ccggaatacctggcgctgcggcgctggttcgcctcgaagcacgagcgcatcgtctcgggc
cgcgtggtctacggcgtgcgcctgccggccggcgacgaactgtatctgacggagatcgag
gccgacctgggcgagcggcgcgaacgctacgtggtgccgctgggactgatctgggaagaa
accctgccgcagttgcagcagcaactggccctggcgcgcgtgcggcgcggccccatggtg
ggcatggtgaccgatgccttcagcctgcagagcttcgccgtggcggtgttcgacagcctg
aggaacggcgtcgagctggagtcgcgcatcgccgcctccgacggcgggagcgcccgcata
cggttcctgcccgaacctggcctggaagcggtggcggtcgatgccgacacgcccatccgg
tggttgtcggccgaacagtccaacagttcgctggtggccgggaccgcggccgtgctgaag
atcgtgcgccgggtcacggcgggcacccatccggaaagcgagatgacgcgccacctgacg
aagctgggttttcgcaacacggcggcgctgctgggagaagtggtgcgggtggacgaggac
ggcacgccgcacacgctgatgctggcccagcagtacgtggacaaccagggcgatgcctgg
aactggacgctggagtacctgcaccggacgctggacgacgccgcgctgaccgccgagagc
gccgaggactacggccaggagttgcgcggctacgccacgctggccgcggccgtgggccgg
cggctgggcgaactgcacgccgcgctggcgctgccttccgaggatccggccttcgcgccg
gtcgaggcctcgcgcgaggacgtcgcgcgctgggtggacgatacgcggcaaagcctggat
caggcgctggccattctcgccgcgcgcagggactggggcgacctggcggccgacaccgcg
ctgctgctggacaaccgcggcctgctcgaggccgccatcgaccggctcggccaggccgtc
ggcaatgcctggctgacccgggtgcacggggatttccacctgggacaggtgctggtggcg
cagaacgatgcctacatcatcgacttcgagggcgaaccggcgcgcaccatggacgagcgg
cggcgcaagcgcaatccgctgcgcgacgtggcgggcctgttgcgctcgttcgactacgcg
tcggcggtggtcgcgcgggcgccggatgccacggtcccggccgccggtgccaatcccatc
gccggtccgtccgtcgacaccgtggcgcagcgccgcgatgtcctgctcgaacggttccgc
gtcgaagcctcgggcgcgttcctcgatgcctaccgcgaggccgcggccgcggcgccccgg
ccctgggtggacagcaaggacgaggaagcgctgctggcgctgttcctgatcgagaaggcg
gcctacgaagtgtgctacgaagccgccaaccggccggcgtggataggggtgccgctgcgt
ggcctggtgacgctggcgggccggatcgaaccggccatacggagggaagaggatcttgac
ggacaacagccgtga

DBGET integrated database retrieval system