KEGG   Pigmentiphaga sp. H8: EGT29_12120Help
Entry
EGT29_12120       CDS       T05719                                 

Definition
(GenBank) terephthalate 1,2-dioxygenase
  KO
K16320  anthranilate 1,2-dioxygenase small subunit [EC:1.14.12.1]
Organism
pig  Pigmentiphaga sp. H8
Pathway
pig00627  Aminobenzoate degradation
pig01100  Metabolic pathways
pig01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pig00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    EGT29_12120
Enzymes [BR:pig01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     EGT29_12120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ring_hydroxyl_B SnoaL_4
Motif
Other DBs
NCBI-ProteinID: AZG08544
UniProt: A0A3G8GKD7
LinkDB All DBs
Position
2543895..2544368
Genome map
AA seq 157 aa AA seqDB search
MAEFTQERLGILNAAYARCIDNDEVEAWPAFFEERCLYVVNTAENHAAGMEAGVIYADTR
AMLHDRVSALRDANVYERHRYRHIVGQPFVLGIEDGAASVETPFIVVRIMRDGATEVFAS
GRYLDRVVEGADGQLRFARRLAICDSRNIDTLLAIPL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggccgaattcacccaagagcggctgggcatcctgaacgccgcctacgcgcgctgcatc
gacaacgacgaggtcgaggcctggccggcgttcttcgaggagcgctgcctgtacgtggtc
aataccgccgagaaccacgcggccggcatggaggcgggggtgatctacgccgacacgcgc
gccatgttgcacgaccgcgtgtcggcgctgcgcgatgccaacgtctacgagcgccaccgc
tatcgccacatcgtcggccagccgttcgtgctgggcatcgaggatggcgcggccagcgtc
gagacgcccttcatcgtggtgcgcatcatgcgcgatggcgccaccgaggtgttcgcgtcc
ggccgctacctggaccgcgtggtcgaaggcgcggacgggcagctcaggttcgcccggcgg
ctggccatctgcgacagccggaacatcgataccttgctggcgataccgctatga

DBGET integrated database retrieval system