KEGG   Pigmentiphaga sp. H8: EGT29_14820Help
Entry
EGT29_14820       CDS       T05719                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
pig  Pigmentiphaga sp. H8
Pathway
pig00061  Fatty acid biosynthesis
pig00780  Biotin metabolism
pig01100  Metabolic pathways
pig01212  Fatty acid metabolism
Module
pig_M00083  Fatty acid biosynthesis, elongation
pig_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pig00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    EGT29_14820 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    EGT29_14820 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pig01004]
    EGT29_14820 (fabZ)
Enzymes [BR:pig01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     EGT29_14820 (fabZ)
Lipid biosynthesis proteins [BR:pig01004]
 Fatty acid synthase
  Component type
   EGT29_14820 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH AfsA
Motif
Other DBs
NCBI-ProteinID: AZG09030
UniProt: A0A3G8GM42
LinkDB All DBs
Position
complement(3116442..3116888)
Genome map
AA seq 148 aa AA seqDB search
MEMDIKGILDHLPHRYPMLLIDRVIDVKPGESILAIKNVSINEPFFTGHFPHHPVMPGVL
ILEAMAQAAAITSFTAAGKKPDDNTVYYFVGIDGARFKRPVVPGDQLRLEVNVERSSRGI
WKYNGKALVDGQVAAEADLMCTMRILEP
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggacatcaaggggatactcgaccatttgccgcatcgctatccgatgctgctc
atcgatcgggtcatcgacgtcaagcccggggaatcgatcctcgcgatcaagaacgtgtcg
atcaacgaaccgttcttcaccggccatttcccgcatcaccccgtcatgccgggcgtgctg
atcctggaggccatggcccaggcggccgccatcacgtcgttcaccgcggccggcaagaag
cccgacgacaacaccgtgtactacttcgtcggcatcgacggcgcccgcttcaagcggccg
gtggtcccgggcgaccagctccgcctggaagtcaatgtggaacgttcgtcgcgcggcatc
tggaagtacaacggcaaggcgctggtggacggacaggtcgcggccgaggccgacctgatg
tgcaccatgcgcatcctagaaccctga

DBGET integrated database retrieval system