KEGG   Pigmentiphaga sp. H8: EGT29_14930Help
Entry
EGT29_14930       CDS       T05719                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
pig  Pigmentiphaga sp. H8
Pathway
pig03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:pig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    EGT29_14930
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pig03400]
    EGT29_14930
Enzymes [BR:pig01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     EGT29_14930
DNA repair and recombination proteins [BR:pig03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     EGT29_14930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AZG11730
UniProt: A0A3G8GUT4
LinkDB All DBs
Position
complement(3145909..3146736)
Genome map
AA seq 275 aa AA seqDB search
MSAVRRAWLRELGVERLWNLPGAAAPAAAPELAPAAEVPVAPPQSPVRESVATVPAVEPE
RAEPVALVQEIPMQELPAPAAMPADPEQAWAALQDEVRDCVACGLCKGRTQTVFGTGSPK
ARWLLVGEAPGEQEDKQGAPFVGRSGKLLDSMLASIARSRQHDVFIANVIKCRPPGNRDP
LPEEVARCSPYLMRQISFINPEMILVLGRFAAQTLLETDARIGSLRGKVHSLSVAGRKVP
VVVSYHPAYLLRSPAEKVKAWQDLQLALSVGRPGN
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggtccggcgcgcctggctgcgcgagctgggcgtggagcggctgtggaacctg
cccggcgctgccgcgccggcggccgcacccgagcttgcgccggcggcggaggtgcccgtg
gcacctccgcagagtccggtgcgggaatccgtggcgaccgtccccgccgtcgagcccgag
agggccgaacccgtggccctcgtgcaggaaattcccatgcaggagctcccggcgccggcc
gccatgcccgccgatcccgagcaggcctgggccgcgttgcaggacgaggtgcgcgactgc
gtggcctgtggcctgtgcaaggggcgcacgcaaaccgtgttcggcaccggctcgcccaag
gcgcgctggctgctggtgggcgaggcgccgggcgaacaggaagacaagcagggcgcgcct
ttcgtggggcgctcgggcaaactgctcgacagcatgctggcctccatcgcgcgctcgcgc
cagcacgatgtattcatcgccaacgtcatcaaatgccgtccgcccggcaaccgcgacccg
ctgcccgaggaagtggcgcgctgcagtccctacctgatgcggcagatctcgttcatcaac
ccggaaatgatcctggtgctggggcggttcgcggcgcagaccctgctggagaccgacgcg
cgcataggcagcctgcggggcaaggtgcacagcctgtcggtggcgggaaggaaggtgccg
gtggtggtgagctaccatccggcctatctgctgcgcagcccggccgagaaggtcaaggcc
tggcaggacttgcagctggccctgtcggtggggcggcccgggaactga

DBGET integrated database retrieval system