KEGG   Pigmentiphaga sp. H8: EGT29_20020Help
Entry
EGT29_20020       CDS       T05719                                 

Definition
(GenBank) amino acid permease
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
pig  Pigmentiphaga sp. H8
Brite
KEGG Orthology (KO) [BR:pig00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    EGT29_20020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Per1
Motif
Other DBs
NCBI-ProteinID: AZG09957
UniProt: A0A3G8GP76
LinkDB All DBs
Position
4235566..4236984
Genome map
AA seq 472 aa AA seqDB search
MDLFRVKSIDSMLAQRQTAGLRKSLSTFDLVMLGVGAVVGSGIFILTGTGSLIAGPALSL
SFVLAAIACFFSALSYAEFSSALPVSGSVYTYVYATLGELPAWLIGWILILEFGLAASAV
AAGWSGYLQSLIAGFGLHLPEALRAAPGAVSGSASLFNLPAFLVLAAITALLSLGIRQSK
RVNNAMVVIKILVVVLFIAAGATHVRTENWTPFMPYGMSGVYAGAALMFYAFIGFDAVAS
SAEEVRNPQRSLPLGILGSLLICTVLYVLVTLVMTGIVPYQDFTANSDHPVSLALQRTGQ
LGLAGVVDLGAILGMTTVILVMSYGLTRILYAMARDGLLPRRLATLHPRHATPFTLTWSV
GLAFALIAGLVPLAVLAELINIGTLTAFALISLAVIVLRRTHPDLRRGFRCPGVPYVPLA
AVACCVFLIAHLDRITWLAFCVWVLAGLAVYFLYSRRKAVLAAPAGQAGKRQ
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggacctgttccgcgtcaagagcatagacagcatgctggcgcagcgccagacggccggc
ctgcgcaagagcctgtccaccttcgatctcgtcatgctgggcgtgggcgcggtggtcggc
tcgggcatcttcatcctgaccggcaccggcagcctgatcgccggcccggcgctgtcgctg
tccttcgtcctggcggccatcgcctgttttttctcggcgctgtcctatgccgagttctcg
tccgcgctgccggtctccggctcggtctacacctatgtctacgcgacgctgggcgaactg
ccggcctggctgatcggctggatactgatcctggaattcggcctggcggcctcggccgtc
gcggccggctggtccggctacctgcaatcgctgatcgccggcttcggcctgcacctgccc
gaggcgctgcgcgccgcgccgggcgccgtgtccggcagcgcctcgctgttcaacctgccc
gccttcctggtcctggccgccatcaccgccctgttatcgttgggcatccgccagtccaag
cgcgtcaacaacgcgatggtggtgatcaagatcctggtggtggtgctgttcatcgccgcc
ggcgccacccacgtgcggaccgagaactggacgcccttcatgccctacggcatgagcggc
gtgtacgccggcgcggccctgatgttctatgcgttcatcggcttcgacgcggtcgcgtcc
tcggccgaggaagtcaggaatccgcagcggtcgctgccgctcggcatcctgggctcgctg
ctgatctgcaccgtgctgtacgtgctcgtgaccctggtcatgaccggcatcgtgccctac
caggacttcaccgccaactccgaccacccggtgtcgctggccttgcagcgcacggggcag
ctcggcctggccggcgtggtggacctgggcgcgatcctgggcatgacgacggtcatcctc
gtcatgagctacggcctgacgcgcattctctacgccatggcgcgcgacggcctgctgccg
cggcggctggccaccctgcacccgcgccacgcgacgcccttcacgctgacctggtccgtc
gggctggccttcgcgctgatcgccgggctcgtgcccctggccgtgctggccgagctgatc
aatatcggcacgctgaccgccttcgcgctgatctcgctggcggtcatcgtgctgcgccgg
acccatccggacctgcggcgcggcttccgctgccccggcgtcccctacgtgccgctcgcg
gcggtggcctgctgcgtcttcctgatcgcgcatctggaccggatcacctggctggccttc
tgcgtgtgggtgctggcgggcctcgcggtgtatttcctgtattcacgccgcaaggccgtg
ctggccgcgccggcgggacaggccggaaaacgccaatag

DBGET integrated database retrieval system