KEGG   Pigmentiphaga sp. H8: EGT29_20165Help
Entry
EGT29_20165       CDS       T05719                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pig  Pigmentiphaga sp. H8
Pathway
pig00620  Pyruvate metabolism
pig00680  Methane metabolism
pig01100  Metabolic pathways
pig01120  Microbial metabolism in diverse environments
pig01200  Carbon metabolism
Module
pig_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EGT29_20165
  09102 Energy metabolism
   00680 Methane metabolism
    EGT29_20165
Enzymes [BR:pig01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     EGT29_20165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AZG09985
UniProt: A0A3G8GPK4
LinkDB All DBs
Position
4266996..4269839
Genome map
AA seq 947 aa AA seqDB search
MTSSLQDPDLPLRNDIRLLGRLLGDVIRASEGAGVFDTIETVRRTAVRFRRDGNATDGRA
LEKRLKLLAADETNSVVRAFTYYLHLANIAEDRDQNRRRRATLLQQDAPARGSLQDAVTQ
LRAAGIGNARMRQLLDETLISPVLTAHPTEVQRKSTLDVHKEIAHLLQERDDPRTTDESF
EQTLALLGRITTLWQTRMLRNSRLTVADEIENALSYYRSTFLSVIPQLYGHLSRLLGREP
ADPFGPHPTPLKSFLRMGSWIGGDRDGNPNVDAETLNLALLRQSTTAFEYYLDETHALGA
ELSLSALLTPASQALTALAEQGGDLSEHRRDEPYRRALVGIYARLAASARVLTGRGLARR
EAPPAQPYAEPAEFAADLAVIADSLNGHHASPIARLRLSALRQAVDVFGFHLATIDLRQS
SDVHERTVAELFARAGVEADYASLDEAARIELLRRELKEVRPLVSPWLRYSEETTRELEI
FRAAASARQRLGAQAVHHAIVSHTETVSDLLEVLVLQQETGLIAPGGGSTSGHVPADGEG
LMVVPLFETIPDLANGPAIMAQFLDLPEVKARVRHAQRGVQEVMLGYSDSNKDGGFLTSN
WSLYQAERALVEVFRARKVRLRLFHGRGGTVGRGGGSSFDAILAQPPGTVAGQIRLTEQG
EVIQSKYKDADIGRWHLELLTAATLEASLADHTESASAEDALFASYGQTMDRLSATAMRS
YRALVYETPGFADYFFASTPISEIAGLNIGSRPASRKSTGRIEDLRAIPWGFSWGQCRLL
LPGWYGMGAAIDDYLRHGEGTKRQRIEHLQAMARDWPFFRTLLSNMEMVLAKTDLVIASR
YAQLVPDTALRKRIFGAISDEWKRTMSALKLITGQRQLLADNPSLARSIRDRIAYIDPLN
HVQIELIRRYRATLGKAGRAKADPAGRTQNGIHLTINGIAAGLRNTG
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgacctcatcgcttcaagatcccgacctacctcttcgcaacgacatccgactgctgggc
cgccttctgggcgacgtgatccgcgccagcgaaggcgcgggcgtcttcgacaccatcgag
accgtgcgccgcacggcggtgcgctttcgccgcgacggcaacgccaccgacggccgcgcg
ctggaaaaacgcctgaagctgctggcggccgacgagaccaactccgtggtccgcgccttc
acctactacctgcacctggccaacatcgccgaggaccgcgaccagaaccggcgccgccgc
gccaccctgctgcaacaggacgcccccgcgcgcggcagcctgcaggacgccgtcacccag
ttgcgggccgcgggcatcggcaacgcgcgcatgcgccagttgctggacgaaacgctgatc
tcgccggtcctgacggcccaccccaccgaggtgcagcgcaagagcacgctggacgtgcac
aaggaaatcgcccacctgctgcaggagcgcgacgacccgcgcaccacggacgaatccttc
gaacagacgctggccctgctgggccgcatcaccacgttgtggcagacgcgcatgctgcgc
aactcccggctgacggtggccgacgagatcgagaacgcgctgtcctactaccgcagcacc
ttcctgtccgtcatcccgcagctgtacggccatctttcgcgtctgctcggccgcgagccg
gccgatccgttcggcccgcaccccacgccgctcaagtccttcctgcgcatggggagctgg
ataggcggcgaccgcgacggcaatcccaacgtcgatgccgagacgctgaacctggcgctg
ctgcgccagagcacgacggccttcgagtactacctggacgagacccacgcgctgggcgcc
gaactgtccctgagcgcgctgctgacgcccgcctcgcaggcgctgaccgcgctggccgaa
caaggcggcgacctttccgagcatcgccgcgacgagccctaccgccgtgccctggtcggc
atctacgcccgcctggcggcatcggcgcgggtgctgaccggccgcggcctggcccgccgc
gaggccccgcccgcccaaccctatgccgagcccgccgaattcgccgccgacctggcggtg
atcgccgattcgctcaacggccaccatgcctcgcccatcgcccggctgcgcctgtcggcg
ctgcgccaggcggtggacgtgttcggcttccacctggccacgatcgacctgcgccagagt
tccgacgtgcatgaacgcacggtggccgagctgttcgcgcgcgccggggtcgaggccgac
tacgccagcctggacgaagccgcgcgcatcgaactgctgcggcgcgagttgaaggaggtc
cgcccgctggtctcgccctggctgcgctacagcgaggaaacgacccgcgaactggagatt
ttccgggccgccgccagcgcccgccagcgcctgggcgcgcaggccgtgcaccacgccatc
gtgtcgcacacggaaacggtcagcgacctgctggaagtcctggtgctgcagcaggaaacc
ggcctgatcgcgccggggggcggctccacgagcggccacgttcccgccgacggcgaaggg
ctgatggtggtgccgctgttcgagaccattcccgacctggccaacggccccgccatcatg
gcgcagttcctcgacctgcccgaggtcaaggcgcgcgtgcgccatgcccagcgcggcgtg
caggaagtgatgctgggctattccgacagcaacaaggacggtggcttcctgacgtcgaac
tggtccctgtaccaggcagaacgcgcgctggtcgaggtcttccgcgcccgcaaggtcagg
ctgcgcctgttccacggccgcggcggcaccgtgggccggggcggcggttcgagcttcgac
gccatcctggcgcagcctccgggtaccgtggccggccagatccggctgaccgaacagggc
gaggtcatccagagcaaatacaaggacgccgacatcggccgctggcatctcgaactgctg
accgccgccacgctggaggccagcctggccgaccacaccgaaagcgcctcggccgaggac
gcgctgttcgccagctatggccagaccatggaccgcctgtcggccaccgccatgcgcagc
tatcgggccctggtctacgaaacgccggggttcgccgactacttcttcgcttcgacgccg
atctccgagatcgccggcctgaacatcggttcgcgcccggcctcgcgcaaatccaccggg
cgcatcgaggacctgcgcgccattccctggggcttctcgtggggccagtgccggctgctg
ctgccgggctggtacggcatgggcgcggccatcgacgactacctgcgccacggcgaaggc
accaagcgccagcgcatcgaacacctgcaggccatggcgcgcgactggccgttcttccgc
acgctgctgtccaacatggaaatggtgctggccaagaccgacctggtcatcgcctcgcgc
tatgcccagctggtgcctgacaccgcgctgcgcaagcgcatcttcggcgcgatcagcgac
gagtggaagcgcaccatgagcgcgctgaagctgattaccggccagcgccagttgctggcc
gacaatccctcgctggcacgctcgatccgcgaccgcatcgcctacatcgatccgctcaat
cacgtgcagatcgaactgatccgccgctatcgcgccaccctcggcaaggcgggccgcgcc
aaggccgatccggccggccggacccagaacggcattcacctgaccatcaacggcatcgcc
gcgggcctgcgcaacaccggctga

DBGET integrated database retrieval system