KEGG   Pigmentiphaga sp. H8: EGT29_22865Help
Entry
EGT29_22865       CDS       T05719                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pig  Pigmentiphaga sp. H8
Pathway
pig00564  Glycerophospholipid metabolism
pig01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pig00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EGT29_22865
Enzymes [BR:pig01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EGT29_22865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 HI0933_like FAD_binding_3 NAD_binding_8 3HCDH_N GIDA Lycopene_cycl Pyr_redox Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AZG10486
UniProt: A0A3G8GQB9
LinkDB All DBs
Position
complement(4861384..4863105)
Genome map
AA seq 573 aa AA seqDB search
MGAGPALRALDVRDRPPRQGRTLARGRRAFARLGPDLTASTQAPLRTDRAGLLARLAEPG
GYDVAVIGGGATGLGVALDAATRGLRVVLVEAHDFAKGTSSRATKLIHGGVRYLAQGNLP
LVREALRERQILLRNAPHLAQPLPFVVPAYRLGERPFYGTGLVLYDALAGKAGLGRTRWL
DARATLARQPALRAQGLRGGIEYWDGQFDDARMAIALARTAAQAGALLLNYCAAVDFIRE
GGKVAGLRCEDAETGRSYGIRAKCVVNAAGIWVDAVRGLGRETPQAEPTVTFSQGAHIVV
PRTFLPGDRAVLIPRTRDGRVLFALPWMGRTVIGTTDTPRPRVVLEPRPLSTEVAFLLGE
AGRYLARAPGIDDISSAWAGLRPLVRPGGFVSTKNISREHQVRIDGDGLVTVAGGKWTTY
RAMAEDTLDACIAAGLLKTAKSSATADWPLVGAAPGRHRVADMPDIRGYGSEQEAVLALH
GAQRDLGGGLTEAMVRFAARHEYARTVEDVLARRSRLLFLDARLARAVAAEVGRLLREET
GADPCVEVFCGLAEAYLRWPEEVSSSGSTSFSR
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgggcgctggaccggcgcttcgagccctcgatgtccgagaccgcccgccgcgccaaggt
cgaacgctggcgcgaggccgtcgcgcgttcgcgcgcctgggcccggacttgaccgcgtcc
acgcaggcgccgctgcgcaccgaccgggccggattgctggcccggctggccgaacccggg
ggttacgacgtggcggtgatcggcggcggcgccaccggcctgggcgtggcgctggatgcg
gccacgcggggcctgcgcgtggtgctggtcgaggcccacgacttcgccaagggaacgtcc
tcccgcgccaccaaactcatccacggcggcgtgcgctatctcgcccagggcaacctcccg
ctggtgcgggaggccctgcgggagagacaaatccttctgcgcaacgccccgcacctggcc
cagccgttaccttttgtcgtgcccgcctatcgcctgggtgagaggccgttctacgggaca
ggactggtcctgtacgatgccctggccggcaaggccgggctcggccgtacccgatggctc
gacgcgcgcgcaaccttggcgcgacagccggcgctgcgggcgcaagggctgcgcggcggg
atcgaatattgggacgggcagttcgacgatgcgcggatggcgatcgcattggcgcgcacg
gccgcgcaggcgggcgcgctgctgctcaattattgcgccgccgtggacttcatccgggaa
ggcggcaaggtggccgggctgcgctgcgaggatgccgaaaccgggcggtcatacgggata
cgcgcgaaatgcgtggtgaacgcggcgggcatctgggtggacgcggtgcgcggcctcggg
cgcgagacgccgcaggccgagccgaccgtcaccttcagccagggcgcgcacatcgtcgtg
ccccgcacgttcctgccaggtgatcgcgccgtgctgattccacgcacgcgcgacggacgt
gtgctgttcgcgctgccatggatgggcaggaccgtcatcggcaccaccgacacgccgcgt
ccccgcgtcgtgcttgaaccgcgaccgctgtcgaccgaagtggccttcctgctcggcgag
gcgggacgctacctggcccgcgcgccgggcatcgacgacatctctagtgcctgggcggga
ttgcgcccgctcgtgcgtccgggcggcttcgtcagcactaagaacatcagccgcgagcac
caggtgcggatcgacggcgacgggctggtcacggtggcgggcggcaaatggacgacgtac
cgcgccatggccgaggatacgctcgacgcatgcatcgcggcggggctgctgaagaccgcg
aaatcgagcgcgaccgccgactggccgctggtgggtgccgcgccggggcggcaccgtgtt
gccgacatgcccgacatccggggatatggcagcgagcaggaggcggtgctggcgttgcac
ggcgcccaacgagacctgggcggcgggctgaccgaagccatggtgcggttcgccgcgcgc
cacgaatacgcccgcaccgtggaggacgtgctggcgcgccgctcgcgcctgctgttcctc
gatgcccggctggcgcgcgcggtggcggccgaggtcgggcgcctgctgagggaggaaacc
ggcgcggatccgtgcgtcgaggtcttttgcgggctggccgaggcctacttgcgctggccc
gaggaggtgtcatcctcgggtagcaccagtttctccaggtag

DBGET integrated database retrieval system