KEGG   Paenibacillus sp. IHBB 10380: UB51_04445Help
Entry
UB51_04445        CDS       T03836                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pih  Paenibacillus sp. IHBB 10380
Brite
KEGG Orthology (KO) [BR:pih00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pih01001]
    UB51_04445
Enzymes [BR:pih01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     UB51_04445
Protein kinases [BR:pih01001]
 Serine/threonine kinases: Other
  Bacterial family
   UB51_04445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like Kdo RIO1 FTA2 SP2 Haspin_kinase Seadorna_VP7 Spuma_A9PTase YukC
Motif
Other DBs
NCBI-ProteinID: AJS57865
UniProt: A0A0D3V712
LinkDB All DBs
Position
1010796..1013060
Genome map
AA seq 754 aa AA seqDB search
MIGHELGGRYEIIERIGGGGMALVYKAHDILLGRNVAIKVLRQQFVHDEEFIRRFRREAQ
SAASLSHPNVVSIYDVGQEDEIHYIVMEYVEGYNLNEIIKERAPLQVEESVRIATQICDA
LDHAHQNQIIHRDIKPHNILIGRNGRVKVTDFGIARAVTSTTITQTGSLIGSVHYFSPEH
AKGVATGEKSDLYSLGIVMYQMLTATLPFLGESPISVALKHLQEEFDDPRDVNPLIPQSV
ENIILKSMRKNPHERYQSAKEMIVDIETSLLPERRNEPKMQFADFDADQTRALPAIKVQQ
QGTSLRRNKDLFNEDDEDDKPMTSNKGKKKWTKPVLWISLTLFILIAMGSIVWYVNNKLS
VQEVAVPSVINMQEDAAVAKLKEFGIEVGEITRAYNPEFDEGMVYDQSKKEGTTIKEGSS
INLSVSTIKPFVTMPDVKSLTFEEASKILIGKKIKEDNIKQTSDYSDEPSGTVISQSPGA
NAEFDGDTQEIVLTVSKGPKNIPMPNLVGKTQQDAQSELENLGLELEAIKEDTSFQIEKG
KVTQQWPYDPKAPVSPGSPGSKITLFVSTGYPAEALDYTFRLPVAPVEEGKKTKVRIVYS
DARNEEGSTKEYGTQTIQTTQVFPVKLVLMPNKDAVVSVYLDGKPFDEFRIRYNDVKNGT
VPEVVLPQKDPVVPPITEDEPVDVVPDQNNEEDPKGNADNNTDDVEDDTTAMTSSGKLDN
NNKNKDKGHKGNKDNRDNRGNDRNNGNRLTSSRP
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacatgaattgggcggtcgttatgaaattatcgagcgaattggtgggggcgga
atggccctcgtctataaagctcatgatattttgttgggccgaaacgttgctattaaggtg
cttcgtcaacagtttgtgcacgatgaagagtttattcggcggtttagacgcgaggctcaa
tcagcggcgtctttatctcatcccaatgtagttagtatttacgatgttgggcaagaagat
gaaattcattatattgtgatggagtatgtcgaaggttataatctgaatgaaattattaag
gagcgagcacccttgcaggtggaagaatctgtgagaattgctacgcaaatttgtgatgca
ctggatcatgcacatcagaaccaaattattcatcgagacattaagcctcataacattctt
attggtcgaaatggtcgagtgaaagttactgacttcggtatcgcaagggcagtgacttca
acaacgattacacagacgggttctttgatagggtctgtgcattatttttctcccgagcat
gctaaaggcgttgccacaggcgagaaatctgacttatattctcttggtattgtcatgtac
cagatgttgacggctacactcccttttctaggagaaagtccaatcagcgtggccttgaaa
catttacaagaggaatttgacgatccgcgagatgtgaatccacttattccgcaaagtgta
gagaatattatattgaaatccatgcgcaaaaaccctcatgaacgctatcagtcagcgaaa
gagatgatagtagatatagagactagcttacttcctgagagaagaaatgaacctaaaatg
caatttgctgattttgatgcagatcagacgcgggcattacccgcaattaaagtacagcag
caaggaacatctcttagaagaaataaggatctattcaatgaagatgatgaggatgataag
cctatgacaagcaataaaggcaagaagaagtggaccaagcctgtactttggatatcatta
acgctctttatattaattgctatgggaagtattgtctggtatgtgaacaataagttatcc
gtacaggaagtcgcagttccgagtgtgatcaacatgcaggaagatgctgcagtggctaaa
ctgaaggagttcggcattgaagttggtgagatcacacgtgcgtacaatcctgagtttgac
gaaggtatggtttatgaccagagtaagaaggagggtacgacgatcaaggaaggatcgagt
attaatctttcggtcagcacaataaagccgtttgtcaccatgccggatgtgaaaagtcta
acttttgaagaggcatccaagatactcattggtaaaaagattaaagaagataatattaaa
caaacaagtgattacagtgatgaacctagtggaaccgttatttctcagagtccaggagcg
aacgcggagttcgatggagatacgcaggagattgttttaaccgtaagtaaaggtccgaaa
aacattcctatgcctaacctagttggtaagactcagcaggacgcacagagcgagcttgag
aatttagggctagagcttgaagccattaaggaagatactagcttccagattgaaaaaggc
aaggtaacgcagcagtggccatacgatccgaaggcacctgtatctcctggttctcctggt
tcaaagattacactgtttgttagcacaggctatccagcagaagcgttagattatacgttc
aggctacccgttgcacctgtagaggaaggtaagaagacgaaggttcgtatcgtttactct
gatgcacgtaatgaagagggctcgaccaaagagtatggtacacagacgattcagactaca
caagttttcccggttaagttagtgctgatgccaaataaagatgctgttgtttcagtgtat
ctggacggaaaaccttttgatgagttccgtattcgttataatgatgttaagaatggtact
gttcctgaagtggtacttccgcagaaggaccctgtagtaccacctattactgaggatgag
cctgttgacgtggttccagatcagaataatgaggaagaccctaaagggaatgctgacaat
aatactgatgatgtagaggacgatacaacggctatgacatcttccggtaagttagataac
aataataagaacaaagataaaggtcataaaggaaataaagataatagagataatagaggt
aatgatagaaataacggcaaccgattaacttcttctagaccataa

DBGET integrated database retrieval system