KEGG   Paenibacillus sp. IHBB 10380: UB51_21945Help
Entry
UB51_21945        CDS       T03836                                 

Definition
(GenBank) peptide ABC transporter ATPase
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
pih  Paenibacillus sp. IHBB 10380
Pathway
pih02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pih00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    UB51_21945
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pih02000]
    UB51_21945
Transporters [BR:pih02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    UB51_21945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N ATP-synt_ab AAA_22 AAA_16 AAA TniB RNA_helicase IstB_IS21 AAA_5 AAA_7 NACHT AAA_25
Motif
Other DBs
NCBI-ProteinID: AJS60677
UniProt: A0A0D3VG80
LinkDB All DBs
Position
complement(4841983..4842972)
Genome map
AA seq 329 aa AA seqDB search
MAKDLVEFRNLKTHFHTSDGIVKAVDDVSFTIREGETLCVVGESGCGKSVTAMSLMRLVE
TPPGEIAGGEILFEGKDILKMSKREMSLIRGNDISIIFQEPMSSLNPVLTIGEQIAEPIM
LHLMMNRKEARLKAIELINLVGIPRAEKIYDSFPHELSGGMRQRIMIAIALSCNPKLLIA
DEPTTALDVTIQAQILDLMRDIKDKMNTSIMLITHDLGVVAEMADYVVVMYAGKVIEEAP
VLELFREPKHPYTQGLLKAKPIINQEQERLYSIPGQVPNPVDLGNNCHFHDRCEFCMDIC
KTKQPPFQSHTDGTHKVACWLYEEEREVH
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagatttagtagagtttcgtaatttgaaaacgcattttcatacatctgatgga
attgtaaaagcggtcgatgacgttagctttacaattcgtgaaggcgagacactgtgtgtc
gttggagaatcaggatgtggtaagagtgtcacggcgatgtctctcatgcgtttagttgag
actcctccaggggaaatcgccggaggggaaatattgttcgaaggtaaagatattctcaag
atgagcaaacgtgaaatgagcttaatccgtgggaatgatatctcaattattttccaagaa
ccgatgtcatcactgaatccagtgttgactataggggagcagattgcagaacctattatg
cttcatctcatgatgaatcgtaaagaagcacgcttgaaggctattgagcttattaatctg
gttggaattccacgtgcagagaaaatatatgattcgtttcctcacgaattaagtggaggc
atgcgtcaacggattatgattgcgattgcactaagttgtaatcccaagttgcttattgct
gacgaacctaccactgcacttgatgtaactattcaggcccaaatattggacttaatgcgt
gatatcaaggataagatgaacacttcgattatgcttatcacccatgaccttggtgtggtg
gctgaaatggccgattacgttgtcgttatgtatgctggtaaagtgattgaggaggctcct
gtactggaattgtttagagagcctaaacatccatatacgcaaggactgttaaaagctaag
cccattattaatcaagagcaggaacgtctatactccatacctgggcaagttcctaaccct
gttgatctaggtaacaactgtcatttccatgatcgttgtgagttctgtatggatatctgt
aaaacgaaacaacctccattccagtcacatacagatggtacacataaagtagcctgttgg
ttatatgaggaagagagggaagtacattga

DBGET integrated database retrieval system