KEGG   Paenibacillus sp. IHBB 10380: UB51_23710Help
Entry
UB51_23710        CDS       T03836                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pih  Paenibacillus sp. IHBB 10380
Pathway
pih03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pih00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    UB51_23710
Enzymes [BR:pih01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     UB51_23710
DNA repair and recombination proteins [BR:pih03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     UB51_23710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AJS60960
UniProt: A0A0D3VFK1
LinkDB All DBs
Position
complement(5229550..5230500)
Genome map
AA seq 316 aa AA seqDB search
MKLNPIRPFEPIRTEIIPTGPQWITQVKWDGVRMLTYYDGLTVRLANRKLNDRTQQYPEF
QSPNVYCSASSFIIDGEIVAWEEGKPSFHEVMKRDSARKQQSIELASRQISVTYIVFDVL
FANGEWVIDQPLSVRQNLLNEIITPQPHVQIAQSFKEGSTLFEAIKQQGMEGIICKNIDS
SYIINGKDNRWQKVKTEQDLYAVVGGLTYKDGVVSSLLLGLFNEEGNYIYIGNAGAGKLT
MKEWAALTSRMLPIQIDTNPFSNVPQRSKGAIWLKPTIVVKVNFLEWTHSGTLRHSCIQG
VIEDMSISDCRFSQNK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttaatcctattagaccgttcgagcctatacgtactgagatcatacccacaggt
ccacagtggatcactcaagtaaagtgggatggcgttagaatgcttacctattatgacggg
cttaccgtcagattggcgaatcgtaaacttaacgatcgcacgcagcagtatcctgaattc
cagtctcctaacgtctactgctcagcatcatccttcattattgatggggaaattgtagct
tgggaggaaggtaaaccttcattccatgaagttatgaaaagagatagcgcccgcaaacaa
cagagtattgaattagcttcaagacaaatctctgtgacttatattgtttttgatgttctt
tttgcaaatggtgaatgggtcatagatcagcctctatctgtgagacagaatctcctaaac
gaaatcatcacaccacaaccccatgtacaaattgcccagagtttcaaagaaggtagcact
ttatttgaggctattaaacaacagggtatggaggggattatatgcaaaaatatagacagc
tcctatatcatcaatggcaaagataatcgttggcaaaaggtaaaaacggagcaggactta
tatgccgtggtaggtgggctaacgtataaagatggcgtcgtcagctcgcttcttctaggt
ctctttaatgaagaagggaattatatatacattgggaatgctggagccggaaaattaacg
atgaaggaatgggccgctctgacgagtaggatgcttcccatacagatagatacaaaccct
ttctcgaacgttccccagcgaagcaagggggctatttggttaaaaccaactatcgtggta
aaagtgaattttctagaatggacgcatagtggcaccttaagacactcttgtattcaaggt
gtcatagaggatatgtctatatccgattgtcgtttcagtcagaataaataa

DBGET integrated database retrieval system